| IED ID | IndEnz0018000011 |
| Enzyme Type ID | peroxidase000011 |
| Protein Name |
Glutathione peroxidase-like peroxiredoxin gpx1 EC 1.11.1.24 Glutathione peroxidase homolog GPx Thioredoxin peroxidase gpx1 |
| Gene Name | gpx1 SPBC32F12.03c |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota Taphrinomycotina Schizosaccharomycetes Schizosaccharomycetales Schizosaccharomycetaceae Schizosaccharomyces Schizosaccharomyces pombe (Fission yeast) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
| Enzyme Sequence | MSHFYDLAPKDKDGNPFPFSNLKGKVVLVVNTASKCGFTPQYKGLEALYQKYKDRGFIILGFPCNQFGNQEPGSDEEIAQFCQKNYGVTFPVLAKINVNGDNVDPVYQFLKSQKKQLGLERIKWNFEKFLVNRQGQVIERYSSISKPEHLENDIESVL |
| Enzyme Length | 158 |
| Uniprot Accession Number | O59858 |
| Absorption | |
| Active Site | ACT_SITE 36; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:P40581 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000269|PubMed:18162174}; |
| DNA Binding | |
| EC Number | 1.11.1.24 |
| Enzyme Function | FUNCTION: Glutathione peroxidase-like protein that protects cells during oxidative stress. Has peroxidase activity reducing hydrogen peroxide, alkyl and phospholipid hydroperoxides using preferentially thioredoxin as a reducing power. May act as a scavenger of H(2)O(2). {ECO:0000269|PubMed:10455235, ECO:0000269|PubMed:20356456}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (1) |
| Keywords | Antioxidant;Cytoplasm;Disulfide bond;Mitochondrion;Oxidoreductase;Peroxidase;Redox-active center;Reference proteome;Stress response |
| Interact With | |
| Induction | INDUCTION: By oxidative, osmo- and heat stress. {ECO:0000269|PubMed:10455235}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:18162174}. Mitochondrion {ECO:0000269|PubMed:18162174}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 20473289; 20625380; 21760946; 23697806; 24521463; 25452419; 25720772; 26412298; 27918601; 30726745; 34250083; |
| Motif | |
| Gene Encoded By | |
| Mass | 18,061 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62620 |
| Cross Reference Brenda |