| IED ID | IndEnz0018000042 |
| Enzyme Type ID | peroxidase000042 |
| Protein Name |
Alkyl hydroperoxide reductase E EC 1.11.1.29 Mycoredoxin-dependent peroxiredoxin Peroxiredoxin AhpE Prx Thioredoxin peroxidase TPx |
| Gene Name | ahpE Rv2238c MTCY427.19c |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Enzyme Sequence | MLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALTA |
| Enzyme Length | 153 |
| Uniprot Accession Number | P9WIE3 |
| Absorption | |
| Active Site | ACT_SITE 45; /note="Cysteine sulfenic acid (-SOH) intermediate"; /evidence="ECO:0000269|PubMed:15701515, ECO:0000305|PubMed:19737009, ECO:0007744|PDB:1XVW" |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[mycoredoxin]-L-dithiol + a hydroperoxide = [mycoredoxin]-L-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62640, Rhea:RHEA-COMP:16137, Rhea:RHEA-COMP:16138, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.29; Evidence={ECO:0000269|PubMed:19737009}; |
| DNA Binding | |
| EC Number | 1.11.1.29 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. May represent an important antioxidant defense against cytotoxic peroxides, especially peroxynitrite, which can be formed by activated macrophages during infection. {ECO:0000269|PubMed:19737009, ECO:0000269|PubMed:24379404}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Beta strand (7); Chain (1); Domain (1); Helix (6); Turn (4) |
| Keywords | 3D-structure;Antioxidant;Oxidoreductase;Peroxidase;Redox-active center;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (7) |
| Cross Reference PDB | 1XVW; 1XXU; 4X0X; 4X1U; 4XIH; 5C04; 5ID2; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,819 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62640 |
| Cross Reference Brenda | 1.11.1.29; |