| IED ID | IndEnz0018000043 |
| Enzyme Type ID | peroxidase000043 |
| Protein Name |
Ankyrin repeat domain-containing protein 2A AtAKR2 |
| Gene Name | AKR2A AFT AKR2 At4g35450 F15J1.20 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MASNSEKNPLLSDEKPKSTEENKSSKPESASGSSTSSAMPGLNFNAFDFSNMASILNDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVNTMQQVMHNPEFKTMAEKLGTALVQDPQMSPFLDAFSNPETAEHFTERMARMKEDPELKPILDEIDAGGPSAMMKYWNDPEVLKKLGEAMGMPVAGLPDQTVSAEPEVAEEGEEEESIVHQTASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNSQLEVVKLLEKDAFL |
| Enzyme Length | 342 |
| Uniprot Accession Number | Q9SAR5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 223; /note=Monogalactosyldiacylglycerol (MGDG); /evidence=ECO:0000269|PubMed:25203210; BINDING 246; /note=Monogalactosyldiacylglycerol (MGDG); /evidence=ECO:0000269|PubMed:25203210; BINDING 294; /note=Phosphatidylglycerol (PG); /evidence=ECO:0000269|PubMed:25203210; BINDING 296; /note=Phosphatidylglycerol (PG); /evidence=ECO:0000269|PubMed:25203210 |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Exhibits chaperone activity toward chloroplast outer envelope membrane, mitochondrion outer membrane, endoplasmic reticulum membrane and peroxisomal proteins, by recruiting specific proteins containing a single transmembrane associated with an AKR2A-binding sequence (ABS) and subsequently binding glycolipids (e.g. monogalactosyldiacylglycerol (MGDG) and phosphatidylglycerol (PG)) present in the membrane of the target organelle (PubMed:18193034, PubMed:20215589, PubMed:25203210). Seems to be involved in the regulation of hydrogen peroxide levels during biotic and abiotic stresses by optimizing the ascorbate peroxidase 3 (APX3) hydrogen peroxide-degrading activity. This regulation might be monitored by GRF6. Cytosolic targeting factor for chloroplast outer membrane (COM) proteins that mediates sorting and targeting of nascent chloroplast outer envelope membrane (OEM) proteins to the chloroplast. Facilitates the targeting of OEP7 to chloroplasts (PubMed:18193034). Facilitates the targeting of APX3 to peroxisomes. Involved in cellular metabolism (e.g. peroxisome activity) and required for plant growth and development (PubMed:20215589). {ECO:0000269|PubMed:11862948, ECO:0000269|PubMed:18193034, ECO:0000269|PubMed:20215589, ECO:0000269|PubMed:25203210}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Binding site (4); Chain (1); Compositional bias (2); Erroneous initiation (1); Helix (8); Mutagenesis (7); Region (1); Repeat (4); Sequence conflict (2); Turn (1) |
| Keywords | 3D-structure;ANK repeat;Alternative splicing;Chaperone;Chloroplast;Cytoplasm;Lipid-binding;Membrane;Nucleus;Plastid;Plastid outer membrane;Reference proteome;Repeat |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:20215589}. Nucleus {ECO:0000269|PubMed:20215589}. Plastid, chloroplast outer membrane {ECO:0000269|PubMed:25203210}; Peripheral membrane protein {ECO:0000269|PubMed:25203210}; Cytoplasmic side {ECO:0000269|PubMed:25203210}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 4TUM; 5EID; |
| Mapped Pubmed ID | 24529374; 25880450; 32433816; |
| Motif | |
| Gene Encoded By | |
| Mass | 36,984 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |