| IED ID | IndEnz0018000054 |
| Enzyme Type ID | peroxidase000054 |
| Protein Name |
Arachidonate 5-lipoxygenase-activating protein FLAP MK-886-binding protein |
| Gene Name | ALOX5AP FLAP |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP |
| Enzyme Length | 161 |
| Uniprot Accession Number | P20292 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes. {ECO:0000269|PubMed:2300173, ECO:0000269|PubMed:8440384}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Helix (6); Intramembrane (1); Mutagenesis (9); Region (2); Sequence conflict (1); Topological domain (5); Transmembrane (4) |
| Keywords | 3D-structure;Endoplasmic reticulum;Leukotriene biosynthesis;Membrane;Nucleus;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | Q13520; O15552; O15529; Q9H115; P35372-10; A0PK00; Q96FB2 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (4) |
| Cross Reference PDB | 2Q7M; 2Q7R; 6VGC; 6VGI; |
| Mapped Pubmed ID | 12571239; 12629151; 12911785; 14702425; 14749922; 15593193; 15640973; 15731479; 15784112; 15861005; 15876305; 15886380; 16127181; 16144515; 16282974; 16778124; 16939001; 17387518; 17460547; 17505527; 17627106; 17655870; 18084092; 18184802; 18318662; 18323512; 18366797; 18369664; 18374923; 18398223; 18398440; 18506375; 18547289; 18647347; 18775537; 18843019; 18945963; 18977990; 19046748; 19126581; 19130089; 19131661; 19166692; 19288030; 19336475; 19361804; 19417766; 19423540; 19450127; 19524426; 19596330; 19622707; 19729601; 19948975; 20014490; 20067482; 20128419; 20194722; 20357438; 20369037; 20376802; 20379614; 20406964; 20438785; 20485444; 20592751; 20810156; 21153769; 21199733; 21227888; 21675249; 21893978; 21988832; 22051033; 22074807; 22129473; 22206291; 22537113; 22726381; 22849376; 23076369; 23404351; 23546934; 23765972; 23828562; 24148560; 24183033; 24198186; 24368493; 24411318; 24485247; 24635928; 24641614; 24905297; 25010723; 25025775; 25034252; 25242267; 25534367; 25721704; 25815512; 25862617; 26159646; 26289316; 26327594; 26842853; 27129215; 27350673; 27416969; 28101761; 28160477; 29041000; 29096760; 29392977; 30003372; 3006030; 30291962; 30313062; 30678701; 3118366; 3164719; 31992246; 32165305; 33246032; 33454679; 3579953; 3770188; 6089195; 6422933; 7568157; 7937884; 8052639; |
| Motif | |
| Gene Encoded By | |
| Mass | 18,157 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |