| IED ID | IndEnz0018000079 |
| Enzyme Type ID | peroxidase000079 |
| Protein Name |
Coproheme decarboxylase EC 1.3.98.5 Coproheme III oxidative decarboxylase Hydrogen peroxide-dependent heme synthase |
| Gene Name | chdC LMOf2365_2146 |
| Organism | Listeria monocytogenes serotype 4b (strain F2365) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Listeriaceae Listeria Listeria monocytogenes Listeria monocytogenes serotype 4b Listeria monocytogenes serotype 4b (strain F2365) |
| Enzyme Sequence | MNEAVKTLDGWFCLHDFRSIDWAAWRELNPGNQELMLNELSHFLSDMEITKNIGEGEHTIYSILGQKADLVFFTLRDSLEALNEVENRFNKLAIADYLLPTYSYISVVELSNYLASHMAGGEDPYQNKGVRARLYPALPPKKHICFYPMSKKRDGADNWYMLPMEERQQLIRDHGLIGRSYAGKVQQIIGGSIGFDDYEWGVTLFSDDALEFKRIVTEMRFDEASARYAEFGSFFIGNLLPSEQLSKLFTI |
| Enzyme Length | 251 |
| Uniprot Accession Number | Q71XQ0 |
| Absorption | |
| Active Site | ACT_SITE 147; /evidence=ECO:0000255|HAMAP-Rule:MF_01442 |
| Activity Regulation | |
| Binding Site | BINDING 133; /note=Fe-coproporphyrin III; /evidence=ECO:0000255|HAMAP-Rule:MF_01442; BINDING 187; /note=Fe-coproporphyrin III; /evidence=ECO:0000255|HAMAP-Rule:MF_01442; BINDING 225; /note=Fe-coproporphyrin III; /evidence=ECO:0000255|HAMAP-Rule:MF_01442 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Fe-coproporphyrin III + 2 H(+) + 2 H2O2 = 2 CO2 + 4 H2O + heme b; Xref=Rhea:RHEA:56516, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:16240, ChEBI:CHEBI:16526, ChEBI:CHEBI:60344, ChEBI:CHEBI:68438; EC=1.3.98.5; Evidence={ECO:0000255|HAMAP-Rule:MF_01442};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:56517; Evidence={ECO:0000255|HAMAP-Rule:MF_01442}; CATALYTIC ACTIVITY: Reaction=Fe-coproporphyrin III + H(+) + H2O2 = CO2 + 2 H2O + harderoheme III; Xref=Rhea:RHEA:57940, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:16240, ChEBI:CHEBI:16526, ChEBI:CHEBI:68438, ChEBI:CHEBI:142463; Evidence={ECO:0000255|HAMAP-Rule:MF_01442};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:57941; Evidence={ECO:0000255|HAMAP-Rule:MF_01442}; CATALYTIC ACTIVITY: Reaction=H(+) + H2O2 + harderoheme III = CO2 + 2 H2O + heme b; Xref=Rhea:RHEA:57944, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:16240, ChEBI:CHEBI:16526, ChEBI:CHEBI:60344, ChEBI:CHEBI:142463; Evidence={ECO:0000255|HAMAP-Rule:MF_01442};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:57945; Evidence={ECO:0000255|HAMAP-Rule:MF_01442}; |
| DNA Binding | |
| EC Number | 1.3.98.5 |
| Enzyme Function | FUNCTION: Involved in coproporphyrin-dependent heme b biosynthesis. Catalyzes the decarboxylation of Fe-coproporphyrin III (coproheme) to heme b (protoheme IX), the last step of the pathway. The reaction occurs in a stepwise manner with a three-propionate intermediate. {ECO:0000255|HAMAP-Rule:MF_01442}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Porphyrin-containing compound metabolism; protoheme biosynthesis. {ECO:0000255|HAMAP-Rule:MF_01442}. |
| nucleotide Binding | |
| Features | Active site (1); Binding site (3); Chain (1); Metal binding (1); Region (1) |
| Keywords | Heme;Heme biosynthesis;Iron;Metal-binding;Oxidoreductase |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 28,850 |
| Kinetics | |
| Metal Binding | METAL 174; /note=Iron (Fe-coproporphyrin III axial ligand); /evidence=ECO:0000255|HAMAP-Rule:MF_01442 |
| Rhea ID | RHEA:56516; RHEA:56517; RHEA:57940; RHEA:57941; RHEA:57944; RHEA:57945 |
| Cross Reference Brenda |