| IED ID | IndEnz0018000087 |
| Enzyme Type ID | peroxidase000087 |
| Protein Name |
Catalase-1 EC 1.11.1.6 Fragments |
| Gene Name | |
| Organism | Comamonas terrigena |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Betaproteobacteria Burkholderiales Comamonadaceae Comamonas Comamonas terrigena |
| Enzyme Sequence | THCLTTAAGAPVARFSTVAGERGAADAERDIRRLFSYGDAARRLGVNHQHIPVNAPR |
| Enzyme Length | 57 |
| Uniprot Accession Number | P83657 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=2 H2O2 = 2 H2O + O2; Xref=Rhea:RHEA:20309, ChEBI:CHEBI:15377, ChEBI:CHEBI:15379, ChEBI:CHEBI:16240; EC=1.11.1.6; Evidence={ECO:0000255|PROSITE-ProRule:PRU10013, ECO:0000269|PubMed:12094731, ECO:0000269|PubMed:15177292}; |
| DNA Binding | |
| EC Number | 1.11.1.6 |
| Enzyme Function | FUNCTION: Decomposes hydrogen peroxide into water and oxygen; serves to protect cells from the toxic effects of hydrogen peroxide. {ECO:0000305}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Activity decreases at temperatures above 55 degrees Celsius.; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Active from pH 6.0 to 10.0.; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Metal binding (1); Non-adjacent residues (3); Non-terminal residue (1) |
| Keywords | Direct protein sequencing;Heme;Hydrogen peroxide;Iron;Metal-binding;Oxidoreductase;Peroxidase |
| Interact With | |
| Induction | INDUCTION: Constitutively expressed. Inducible by oxidative stress in the exponential phase of bacterial growth. {ECO:0000269|PubMed:12094731}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,099 |
| Kinetics | |
| Metal Binding | METAL 37; /note=Iron (heme axial ligand); /evidence=ECO:0000250|UniProtKB:P42321 |
| Rhea ID | RHEA:20309 |
| Cross Reference Brenda |