| IED ID | IndEnz0018000137 |
| Enzyme Type ID | peroxidase000137 |
| Protein Name |
Alkyl hydroperoxide reductase AhpD EC 1.11.1.28 Alkylhydroperoxidase AhpD |
| Gene Name | ahpD Oant_3831 |
| Organism | Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) (Ochrobactrum anthropi) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Alphaproteobacteria Hyphomicrobiales Brucellaceae Brucella/Ochrobactrum group Brucella Brucella anthropi (Ochrobactrum anthropi) Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) (Ochrobactrum anthropi) |
| Enzyme Sequence | MSIDDLKSKIPDFAKDVRLNLSSMASDETLTPQQKYGLFVACGIASRNADVRKALVAEAAAKVDASVIQAAKSAASIMGMNNVYYRFVHLATNKDYRTMPAKLRMNVIGNPGVDKIDFELWSLAVSAINGCGMCIDAHEDVLRKANVTSETIQTAVRFASIIQSVAIALEAADTE |
| Enzyme Length | 175 |
| Uniprot Accession Number | A6X5N3 |
| Absorption | |
| Active Site | ACT_SITE 131; /note=Proton donor; /evidence=ECO:0000255|HAMAP-Rule:MF_01676; ACT_SITE 134; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000255|HAMAP-Rule:MF_01676 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=(R)-N(6)-dihydrolipoyl-L-lysyl-[lipoyl-carrier protein] + a hydroperoxide = (R)-N(6)-lipoyl-L-lysyl-[lipoyl-carrier protein] + an alcohol + H2O; Xref=Rhea:RHEA:62636, Rhea:RHEA-COMP:10502, Rhea:RHEA-COMP:16355, ChEBI:CHEBI:15377, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:83099, ChEBI:CHEBI:83100; EC=1.11.1.28; Evidence={ECO:0000255|HAMAP-Rule:MF_01676}; |
| DNA Binding | |
| EC Number | 1.11.1.28 |
| Enzyme Function | FUNCTION: Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity. {ECO:0000255|HAMAP-Rule:MF_01676}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (2) |
| Keywords | Antioxidant;Disulfide bond;Oxidoreductase;Peroxidase;Redox-active center;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 18,873 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62636 |
| Cross Reference Brenda |