| IED ID | IndEnz0018000150 |
| Enzyme Type ID | peroxidase000150 |
| Protein Name |
Alkyl hydroperoxide reductase E EC 1.11.1.29 Mycoredoxin-dependent peroxiredoxin Peroxiredoxin AhpE Prx Thioredoxin peroxidase TPx |
| Gene Name | ahpE BQ2027_MB2262C |
| Organism | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis Mycobacterium bovis Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
| Enzyme Sequence | MLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALTA |
| Enzyme Length | 153 |
| Uniprot Accession Number | P65689 |
| Absorption | |
| Active Site | ACT_SITE 45; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[mycoredoxin]-L-dithiol + a hydroperoxide = [mycoredoxin]-L-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62640, Rhea:RHEA-COMP:16137, Rhea:RHEA-COMP:16138, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.29; Evidence={ECO:0000250|UniProtKB:P9WIE3}; |
| DNA Binding | |
| EC Number | 1.11.1.29 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. May represent an important antioxidant defense against cytotoxic peroxides, especially peroxynitrite, which can be formed by activated macrophages during infection. {ECO:0000250|UniProtKB:P9WIE3}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1) |
| Keywords | Antioxidant;Oxidoreductase;Peroxidase;Redox-active center |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,819 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62640 |
| Cross Reference Brenda |