| IED ID | IndEnz0018000171 |
| Enzyme Type ID | peroxidase000171 |
| Protein Name |
Glutathione S-transferase PM239X14 EC 2.5.1.18 GST class-phi |
| Gene Name | |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MVTVKLYGMAYSTCTKRVYTTAKEIGVDVKIVPVDLMKGEHKEPAYLDNYHPFGVIPVLEDEDGTKIYESRAISRYLVAKYGKGSSLLPSPSDPKAYGLFEQAASVEYSSFDPPASSLAYERVFAGMRGLKTNEELAKKYVDTLNAKMDGYERILSKQKYLAGNDFTLADLFHLPYGAMVAQLEPTVLDSKPHVKAWWAASLRVIPGRLLRNSSKEFM |
| Enzyme Length | 218 |
| Uniprot Accession Number | P42769 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=glutathione + RX = a halide anion + an S-substituted glutathione + H(+); Xref=Rhea:RHEA:16437, ChEBI:CHEBI:15378, ChEBI:CHEBI:16042, ChEBI:CHEBI:17792, ChEBI:CHEBI:57925, ChEBI:CHEBI:90779; EC=2.5.1.18; |
| DNA Binding | |
| EC Number | 2.5.1.18 |
| Enzyme Function | FUNCTION: Specifically catalyzes the conjugation of synthetic 1-chloro-2,4-ditrobenzene to GSH. Also functions as a glutathione peroxidase, converting linoleate oxidation products into their corresponding hydroxyacids. This enzyme may thus serve to protect the cell from oxygen toxicity as well as from exogenous toxins such as herbicides. {ECO:0000269|PubMed:8375395}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (2); Region (4) |
| Keywords | Cytoplasm;Detoxification;Oxidoreductase;Peroxidase;Stress response;Transferase |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 24,364 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16437 |
| Cross Reference Brenda |