| IED ID | IndEnz0018000177 |
| Enzyme Type ID | peroxidase000177 |
| Protein Name |
Hydroperoxy fatty acid reductase gpx1 EC 1.11.1.22 |
| Gene Name | gpx1 slr1171 |
| Organism | Synechocystis sp. (strain PCC 6803 / Kazusa) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Cyanobacteria/Melainabacteria group Cyanobacteria Synechococcales Merismopediaceae Synechocystis unclassified Synechocystis Synechocystis sp. PCC 6803 Synechocystis sp. (strain PCC 6803 / Kazusa) |
| Enzyme Sequence | MTAQANNTIYGFSANALDGSPVALRDFEGKVLLIVNTASQCGFTPQYQGLQALYNRFGDRGFTVLGFPCNQFGQQEPGGSGEIKNFCETRYGVTFPLFEKVEVNGPNAHPLFKFLTAASPGMAIPFLGGAEDIKWNFTKFLVDRQGKVVKRYGSIAKPDEIAADIEKLL |
| Enzyme Length | 169 |
| Uniprot Accession Number | P74250 |
| Absorption | |
| Active Site | ACT_SITE 41; /evidence=ECO:0000250 |
| Activity Regulation | ACTIVITY REGULATION: Mercaptosuccinate, pCMB, and nethylmaleimide act as inhibitors of the catalytic activity. {ECO:0000269|PubMed:11418106}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=a hydroperoxy polyunsaturated fatty acid + H(+) + NADPH = a hydroxy polyunsaturated fatty acid + H2O + NADP(+); Xref=Rhea:RHEA:50876, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:57783, ChEBI:CHEBI:58349, ChEBI:CHEBI:131871, ChEBI:CHEBI:134019; EC=1.11.1.22; Evidence={ECO:0000269|PubMed:11418106}; |
| DNA Binding | |
| EC Number | 1.11.1.22 |
| Enzyme Function | FUNCTION: Hydroperoxy fatty acid reductase essential for the removal of lipid hydroperoxides under normal and stress conditions, leading to the protection of membrane integrity. {ECO:0000269|PubMed:15347790}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 37 degrees Celsius. {ECO:0000269|PubMed:11418106}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 8.2. {ECO:0000269|PubMed:11418106}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1) |
| Keywords | NADP;Oxidoreductase;Peroxidase;Reference proteome |
| Interact With | |
| Induction | INDUCTION: High light, methylviologen, t-butyl hydroperoxide, and salt stress conditions increase the expression level. {ECO:0000269|PubMed:15347790}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 18,452 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=83.1 uM for NADPH {ECO:0000269|PubMed:11418106}; KM=215 uM for alpha-linolenic acid hydroperoxide {ECO:0000269|PubMed:11418106}; |
| Metal Binding | |
| Rhea ID | RHEA:50876 |
| Cross Reference Brenda |