| IED ID | IndEnz0018000178 |
| Enzyme Type ID | peroxidase000178 |
| Protein Name |
Glutathione peroxidase-like peroxiredoxin 1 EC 1.11.1.24 EC 1.11.1.9 Glutathione peroxidase homolog 1 GPx 1 |
| Gene Name | GPX1 YKL026C |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Enzyme Sequence | MQEFYSFSPIDENGNPFPFNSLRNKVVLIVNVASHCAFTPQYKELEYLYEKYKSHGLVIVAFPCGQFGNQEFEKDKEINKFCQDKYGVTFPILHKIRCNGQKQDPVYKFLKNSVSGKSGIKMIKWNFEKFVVDRNGKVVKRFSCMTRPLELCPIIEELLNQPPEEQI |
| Enzyme Length | 167 |
| Uniprot Accession Number | P36014 |
| Absorption | |
| Active Site | ACT_SITE 36; /note="Cysteine sulfenic acid (-SOH) intermediate"; /evidence="ECO:0000305|PubMed:20572871, ECO:0000305|PubMed:22659048" |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=2 glutathione + H2O2 = glutathione disulfide + 2 H2O; Xref=Rhea:RHEA:16833, ChEBI:CHEBI:15377, ChEBI:CHEBI:16240, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297; EC=1.11.1.9; Evidence={ECO:0000269|PubMed:20572871, ECO:0000269|PubMed:22659048}; CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000269|PubMed:20572871, ECO:0000269|PubMed:22659048}; |
| DNA Binding | |
| EC Number | 1.11.1.24; 1.11.1.9 |
| Enzyme Function | FUNCTION: Glutathione peroxidase-like protein that protects cells from phospholipid hydroperoxides and nonphospholipid peroxides during oxidative stress (PubMed:10480913, PubMed:11445588). Has peroxidase activity using thioredoxin or glutathione as a reducing power (PubMed:20572871, PubMed:22659048). Involved in peroxisome formation (PubMed:22659048). {ECO:0000269|PubMed:10480913, ECO:0000269|PubMed:11445588, ECO:0000269|PubMed:20572871, ECO:0000269|PubMed:22659048}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (1); Mutagenesis (1) |
| Keywords | Antioxidant;Disulfide bond;Membrane;Mitochondrion;Mitochondrion outer membrane;Oxidoreductase;Peroxidase;Peroxisome;Redox-active center;Reference proteome |
| Interact With | |
| Induction | INDUCTION: By glucose starvation. {ECO:0000269|PubMed:10480913}. |
| Subcellular Location | SUBCELLULAR LOCATION: Peroxisome matrix {ECO:0000269|PubMed:22659048}. Mitochondrion outer membrane; Peripheral membrane protein {ECO:0000269|PubMed:22659048}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11018134; 11145102; 11283351; 11679167; 11875065; 12702279; 15133656; 15875812; 15953550; 16173060; 17387467; 18021067; 18178164; 18467557; 18768136; 19424433; 19538123; 20002498; 21081499; 21549177; 22094416; 22102822; 22449970; 22970195; 23198979; 23837470; 23974869; 23983899; 24410772; 25173844; 25305535; 25640729; 26261310; 26813659; 26851403; 9315326; |
| Motif | |
| Gene Encoded By | |
| Mass | 19,485 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=141 uM for H(2)O(2) (using glutathione as electron donor) {ECO:0000269|PubMed:20572871}; KM=75 uM for tert-butyl hydroperoxide (using glutathione as electron donor) {ECO:0000269|PubMed:20572871}; KM=120 uM for H(2)O(2) (using thioredoxin as electron donor) {ECO:0000269|PubMed:20572871}; KM=223 uM for tert-butyl hydroperoxide (using glutathione as electron donor) {ECO:0000269|PubMed:20572871}; Vmax=2.98 umol/min/mg enzyme for H(2)O(2) (using glutathione as electron donor) {ECO:0000269|PubMed:20572871}; Vmax=0.579 umol/min/mg enzyme for tert-butyl hydroperoxide (using glutathione as electron donor) {ECO:0000269|PubMed:20572871}; Vmax=0.739 umol/min/mg enzyme for H(2)O(2) (using thioredoxin as electron donor) {ECO:0000269|PubMed:20572871}; Vmax=1.25 umol/min/mg enzyme for tert-butyl hydroperoxide (using thioredoxin as electron donor) {ECO:0000269|PubMed:20572871}; |
| Metal Binding | |
| Rhea ID | RHEA:16833; RHEA:62620 |
| Cross Reference Brenda |