| IED ID | IndEnz0018000179 |
| Enzyme Type ID | peroxidase000179 |
| Protein Name |
Probable glutathione peroxidase 2 EC 1.11.1.9 |
| Gene Name | GPX2 At2g31570 T9H9.9 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MADESPKSIYDFTVKDIGGNDVSLDQYKGKTLLVVNVASKCGLTDANYKELNVLYEKYKEQGLEILAFPCNQFLGQEPGNNEEIQQTVCTRFKAEFPIFDKVDVNGKNTAPLYKYLKAEKGGLLIDAIKWNFTKFLVSPDGKVLQRYSPRTSPLQFEKDIQTALGQASS |
| Enzyme Length | 169 |
| Uniprot Accession Number | O04922 |
| Absorption | |
| Active Site | ACT_SITE 41; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=2 glutathione + H2O2 = glutathione disulfide + 2 H2O; Xref=Rhea:RHEA:16833, ChEBI:CHEBI:15377, ChEBI:CHEBI:16240, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297; EC=1.11.1.9; |
| DNA Binding | |
| EC Number | 1.11.1.9 |
| Enzyme Function | FUNCTION: May constitute a glutathione peroxidase-like protective system against oxidative stresses. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1) |
| Keywords | Cytoplasm;Nucleus;Oxidoreductase;Peroxidase;Reference proteome;Stress response |
| Interact With | |
| Induction | INDUCTION: By salt stress and metals. Up-regulated by salicylic acid (SA). {ECO:0000269|PubMed:14617062}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000269|PubMed:20406884}. Nucleus {ECO:0000269|PubMed:20406884}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11027730; 12028573; 16336779; 17208011; 19000166; 23615222; 24470466; 24662377; 28102911; 28627464; 33316594; |
| Motif | |
| Gene Encoded By | |
| Mass | 18,945 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16833 |
| Cross Reference Brenda |