| IED ID | IndEnz0018000185 |
| Enzyme Type ID | peroxidase000185 |
| Protein Name |
Probable glutathione peroxidase 3, mitochondrial EC 1.11.1.9 |
| Gene Name | GPX3 At2g43350 T1O24.9 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MPRSSRWVNQRATSKIKKFILFLGVAFVFYLYRYPSSPSTVEQSSTSIYNISVKDIEGKDVSLSKFTGKVLLIVNVASKCGLTHGNYKEMNILYAKYKTQGFEILAFPCNQFGSQEPGSNMEIKETVCNIFKAEFPIFDKIEVNGKNTCPLYNFLKEQKGGLFGDAIKWNFAKFLVDRQGNVVDRYAPTTSPLEIEKDIVKLLASA |
| Enzyme Length | 206 |
| Uniprot Accession Number | O22850 |
| Absorption | |
| Active Site | ACT_SITE 80; /evidence=ECO:0000250 |
| Activity Regulation | ACTIVITY REGULATION: The redox states are modulated by H(2)O(2). {ECO:0000269|PubMed:16998070}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=2 glutathione + H2O2 = glutathione disulfide + 2 H2O; Xref=Rhea:RHEA:16833, ChEBI:CHEBI:15377, ChEBI:CHEBI:16240, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297; EC=1.11.1.9; |
| DNA Binding | |
| EC Number | 1.11.1.9 |
| Enzyme Function | FUNCTION: May constitute a glutathione peroxidase-like protective system against oxidative stresses. Involved positively in abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as stomatal closure, seed germination and inhibition of vegetative growth. Oxidizes and represses target proteins (e.g. the phosphatase activity of ABI1 and ABI2) when oxidized by H(2)O(2), probably after ABA signaling. Modulates the calcium channel activity in guard cells in response to ABA or H(2)O(2). Confers tolerance to drought stress, by enhancing the ABA-dependent stomatal closure. {ECO:0000269|PubMed:16998070}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Transit peptide (1) |
| Keywords | Abscisic acid signaling pathway;Mitochondrion;Oxidoreductase;Peroxidase;Reference proteome;Stress response;Transit peptide |
| Interact With | |
| Induction | INDUCTION: By osmotic stress, H(2)O(2), drought stress, and metals. Regulated by abscisic acid (ABA); down-regulated by 1 mM ABA (PubMed:14617062), whereas induced by 60 uM ABA (PubMed:16998070). {ECO:0000269|PubMed:14617062, ECO:0000269|PubMed:16998070}. |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12609038; 15890615; 16125897; 18493039; 18650403; 24192354; 24470466; 28102911; 29224514; 32810779; |
| Motif | |
| Gene Encoded By | |
| Mass | 23,258 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16833 |
| Cross Reference Brenda | 1.11.1.9; |