IED ID | IndEnz0018000190 |
Enzyme Type ID | peroxidase000190 |
Protein Name |
Alkyl hydroperoxide reductase C EC 1.11.1.26 Peroxiredoxin Thioredoxin peroxidase |
Gene Name | ahpC SH2592 |
Organism | Staphylococcus haemolyticus (strain JCSC1435) |
Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus haemolyticus Staphylococcus haemolyticus (strain JCSC1435) |
Enzyme Sequence | MSLINKEILPFIAQAYDPKKDEFKEVSQDDLKGSWSVVCFYPADFSFVCPTELEDLQNQYDKLQDLGVNVFSVSTDTHFVHKAWHDHSDAISKIQYQMIGDPSQTITRNFDVLDEEAGLAQRGTFIIDPDGVVQAAEINADGIGRDASTLVNKIKAAQYVRQHPGEVCPAKWEEGSESLQPGLDLVGKI |
Enzyme Length | 189 |
Uniprot Accession Number | Q4L376 |
Absorption | |
Active Site | ACT_SITE 49; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:P0A251 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=a hydroperoxide + H(+) + NADH = an alcohol + H2O + NAD(+); Xref=Rhea:RHEA:62628, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:57540, ChEBI:CHEBI:57945; EC=1.11.1.26; Evidence={ECO:0000250|UniProtKB:P0A251}; |
DNA Binding | |
EC Number | 1.11.1.26 |
Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. {ECO:0000250|UniProtKB:P0A251}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (1); Chain (1); Disulfide bond (2); Domain (1) |
Keywords | Antioxidant;Cytoplasm;Disulfide bond;Oxidoreductase;Peroxidase;Redox-active center |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:P0AE08}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 21,047 |
Kinetics | |
Metal Binding | |
Rhea ID | RHEA:62628 |
Cross Reference Brenda |