IED ID | IndEnz0018000200 |
Enzyme Type ID | peroxidase000200 |
Protein Name |
Alkyl hydroperoxide reductase AhpD EC 1.11.1.28 Alkylhydroperoxidase AhpD |
Gene Name | ahpD Acid_0411 |
Organism | Solibacter usitatus (strain Ellin6076) |
Taxonomic Lineage | cellular organisms Bacteria Acidobacteria Acidobacteriia Bryobacterales Solibacteraceae Candidatus Solibacter Solibacter usitatus Solibacter usitatus (strain Ellin6076) |
Enzyme Sequence | MELEQLLNSVPEYAKDLKLNMGGVLRQTELTEQQAWGTAVACAIAARNPQLRESVLGEAAKHLNEQALFAAKAAASVMGMNNIFYRFRHLSTNPKYGAMPARLRMQVIAKHGSDPIDFELWCLAVSAMNGCGVCVDSHENVLREKGVSEEAVLAAIRIASTIHGLAAILDVEADPIA |
Enzyme Length | 177 |
Uniprot Accession Number | Q02BZ5 |
Absorption | |
Active Site | ACT_SITE 131; /note=Proton donor; /evidence=ECO:0000255|HAMAP-Rule:MF_01676; ACT_SITE 134; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000255|HAMAP-Rule:MF_01676 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=(R)-N(6)-dihydrolipoyl-L-lysyl-[lipoyl-carrier protein] + a hydroperoxide = (R)-N(6)-lipoyl-L-lysyl-[lipoyl-carrier protein] + an alcohol + H2O; Xref=Rhea:RHEA:62636, Rhea:RHEA-COMP:10502, Rhea:RHEA-COMP:16355, ChEBI:CHEBI:15377, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:83099, ChEBI:CHEBI:83100; EC=1.11.1.28; Evidence={ECO:0000255|HAMAP-Rule:MF_01676}; |
DNA Binding | |
EC Number | 1.11.1.28 |
Enzyme Function | FUNCTION: Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity. {ECO:0000255|HAMAP-Rule:MF_01676}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (2); Chain (1); Disulfide bond (2) |
Keywords | Antioxidant;Disulfide bond;Oxidoreductase;Peroxidase;Redox-active center |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 19,157 |
Kinetics | |
Metal Binding | |
Rhea ID | RHEA:62636 |
Cross Reference Brenda |