| IED ID | IndEnz0018000210 |
| Enzyme Type ID | peroxidase000210 |
| Protein Name |
Chorismate mutase 1, chloroplastic AtCM1 EC 5.4.99.5 CM-1 |
| Gene Name | CM1 At3g29200 MXO21.4 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MEASLLMRSSCCSSAIGGFFDHRRELSTSTPISTLLPLPSTKSSFSVRCSLPQPSKPRSGTSSVHAVMTLAGSLTGKKRVDESESLTLEGIRNSLIRQEDSIIFGLLERAKYCYNADTYDPTAFDMDGFNGSLVEYMVKGTEKLHAKVGRFKSPDEHPFFPDDLPEPMLPPLQYPKVLHFAADSININKKIWNMYFRDLVPRLVKKGDDGNYGSTAVCDAICLQCLSKRIHYGKFVAEAKFQASPEAYESAIKAQDKDALMDMLTFPTVEDAIKKRVEMKTRTYGQEVKVGMEEKEEEEEEGNESHVYKISPILVGDLYGDWIMPLTKEVQVEYLLRRLD |
| Enzyme Length | 340 |
| Uniprot Accession Number | P42738 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Allosterically inhibited by tyrosine and phenylalanine. Activated by tryptophan. {ECO:0000269|PubMed:10564818, ECO:0000269|PubMed:25160622, ECO:0000269|PubMed:8953244}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=chorismate = prephenate; Xref=Rhea:RHEA:13897, ChEBI:CHEBI:29748, ChEBI:CHEBI:29934; EC=5.4.99.5; Evidence={ECO:0000269|PubMed:10564818, ECO:0000269|PubMed:25160622, ECO:0000269|PubMed:8953244}; |
| DNA Binding | |
| EC Number | 5.4.99.5 |
| Enzyme Function | FUNCTION: May play a role in chloroplast biogenesis. {ECO:0000305}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Metabolic intermediate biosynthesis; prephenate biosynthesis; prephenate from chorismate: step 1/1. {ECO:0000269|PubMed:10564818, ECO:0000269|PubMed:8953244}. |
| nucleotide Binding | |
| Features | Beta strand (1); Chain (1); Domain (1); Erroneous initiation (3); Helix (16); Modified residue (1); Mutagenesis (5); Region (1); Sequence conflict (1); Site (1); Transit peptide (1); Turn (2) |
| Keywords | 3D-structure;Acetylation;Allosteric enzyme;Amino-acid biosynthesis;Aromatic amino acid biosynthesis;Chloroplast;Isomerase;Plastid;Reference proteome;Transit peptide |
| Interact With | |
| Induction | INDUCTION: By wounding, P.syringae, bacterial elicitor and the fungal pathogens F.oxysporum and A.raphani. {ECO:0000269|PubMed:10564818, ECO:0000269|PubMed:8953244}. |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast {ECO:0000305|PubMed:22223895}. |
| Modified Residue | MOD_RES 66; /note=N-acetylalanine; /evidence=ECO:0007744|PubMed:22223895 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 4PPU; 4PPV; |
| Mapped Pubmed ID | 12102506; 12169696; 14576160; 17190832; 17337630; 17478635; 18375600; 19567834; 28963347; 9291097; |
| Motif | |
| Gene Encoded By | |
| Mass | 38,239 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=550 uM for chorismate (at pH 8) {ECO:0000269|PubMed:25160622}; KM=2.9 mM for chorismate {ECO:0000269|PubMed:10564818}; Vmax=29 umol/min/mg enzyme with chorismate as substrate (apoenzyme at pH 8) {ECO:0000269|PubMed:25160622}; Vmax=55 umol/min/mg enzyme with chorismate as substrate (in the presence of tryptophan at pH 8) {ECO:0000269|PubMed:25160622}; Vmax=1.4 umol/min/mg enzyme with chorismate as substrate (in the presence of tyrosine at pH 8) {ECO:0000269|PubMed:25160622}; Vmax=1.2 umol/min/mg enzyme with chorismate as substrate (in the presence of phenylalanine at pH 8) {ECO:0000269|PubMed:25160622}; Note=kcat is 16.1 sec(-1) with chorismate as substrate (at pH 8). {ECO:0000269|PubMed:25160622}; |
| Metal Binding | |
| Rhea ID | RHEA:13897 |
| Cross Reference Brenda | 5.4.99.5; |