| IED ID | IndEnz0018000213 |
| Enzyme Type ID | peroxidase000213 |
| Protein Name |
Thioredoxin/glutathione peroxidase BtuE EC 1.11.1.24 EC 1.11.1.9 |
| Gene Name | btuE b1710 JW1700 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MQDSILTTVVKDIDGEVTTLEKFAGNVLLIVNVASKCGLTPQYEQLENIQKAWVDRGFMVLGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVAPEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGKVIQRFSPDMTPEDPIVMESIKLALAK |
| Enzyme Length | 183 |
| Uniprot Accession Number | P06610 |
| Absorption | |
| Active Site | ACT_SITE 37; /evidence=ECO:0000255|HAMAP-Rule:MF_02061 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=2 glutathione + H2O2 = glutathione disulfide + 2 H2O; Xref=Rhea:RHEA:16833, ChEBI:CHEBI:15377, ChEBI:CHEBI:16240, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297; EC=1.11.1.9; Evidence={ECO:0000255|HAMAP-Rule:MF_02061, ECO:0000269|PubMed:20621065}; CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000255|HAMAP-Rule:MF_02061, ECO:0000269|PubMed:20621065}; |
| DNA Binding | |
| EC Number | 1.11.1.24; 1.11.1.9 |
| Enzyme Function | FUNCTION: Non-specific peroxidase that can use thioredoxin or glutathione as a reducing agent. In vitro, utilizes preferentially thioredoxin A to decompose hydrogen peroxide as well as cumene-, tert-butyl-, and linoleic acid hydroperoxides, suggesting that it may have one or more organic hydroperoxide as its physiological substrate. {ECO:0000269|PubMed:20621065}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1) |
| Keywords | Oxidoreductase;Periplasm;Peroxidase;Reference proteome;Stress response |
| Interact With | |
| Induction | INDUCTION: Induced by oxidative stress conditions. {ECO:0000269|PubMed:20621065}. |
| Subcellular Location | SUBCELLULAR LOCATION: Periplasm {ECO:0000305|PubMed:3528129}. Note=Appears to have a periplasmic location. It has the mean hydropathy of a soluble protein but lacks an obvious signal sequence. {ECO:0000305|PubMed:3528129}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 16606699; |
| Motif | |
| Gene Encoded By | |
| Mass | 20,470 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16833; RHEA:62620 |
| Cross Reference Brenda |