| IED ID | IndEnz0018000242 |
| Enzyme Type ID | peroxidase000242 |
| Protein Name |
Putative heme-binding peroxidase EC 1.11.1.- |
| Gene Name | MGG_10368 |
| Organism | Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Sordariomycetidae Magnaporthales Pyriculariaceae Pyricularia Magnaporthe oryzae (Rice blast fungus) (Pyricularia oryzae) Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae) |
| Enzyme Sequence | MASKPGDFDAVRKDIVSLLDQPEYDDGSAGPVLVRLAWHSAGTYDKSTDTGGSNGAGMRYEAEGGDPANAGLQNARQFLEPVKARHPWITYADLRTLAGVVAVRAMGGPEIPWRAGRTDFADDSRVPPRGRLPDATQGAAHVRDIFYRMGFDDREIVALSGAHSLGRCHPANSGFEGKWVNNPTRFSNQYFRLLLSEDWREKTVAGTGLKQFVAVDEVTGDELMMLPTDLSLTSDPVFARWVKVYRDDQDLFFADFAKVFDKLMELGIKRDAEGKVINKENVEGGYVSAPKKQGKIASKL |
| Enzyme Length | 300 |
| Uniprot Accession Number | A4R606 |
| Absorption | |
| Active Site | ACT_SITE 39; /note="Proton acceptor"; /evidence="ECO:0000255|PROSITE-ProRule:PRU00297, ECO:0000255|PROSITE-ProRule:PRU10012"; ACT_SITE 179; /note="Tryptophan radical intermediate"; /evidence="ECO:0000250" |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 1.11.1.- |
| Enzyme Function | FUNCTION: Destroys radicals which are normally produced within the cells and which are toxic to biological systems. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Metal binding (1); Region (2); Site (1) |
| Keywords | Heme;Iron;Metal-binding;Oxidoreductase;Peroxidase;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 32,999 |
| Kinetics | |
| Metal Binding | METAL 163; /note=Iron (heme b axial ligand); /evidence=ECO:0000255|PROSITE-ProRule:PRU00297 |
| Rhea ID | |
| Cross Reference Brenda |