| IED ID | IndEnz0018000287 | 
| Enzyme Type ID | peroxidase000287 | 
| Protein Name | 
                        
                            
                                Putative heme-binding peroxidase  EC 1.11.1.-  | 
                    
| Gene Name | AFUA_6G13570 | 
| Organism | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) | 
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Fumigati Neosartorya fumigata (Aspergillus fumigatus) Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) | 
| Enzyme Sequence | MSKPGDYDAVRKDIIAQLKKPGYDDGSAGPVFVRLAWHSAGTYDLETDTGGSNGAGMRYEAEGGDPANAGLQHGRAFLEPVKEKHPWITYADLWTLAGVVAIEALGGPKVVWKPGRTDLVDDSKVPPRGRLPDATQGAEHLRAVFYRMGFNDQEIVALAGGHTLGRCHIDRSGFQGPWVNNPTRFSNQFFKLLLTLDWKPKTLPNGISQFVYVDPDAEEGDEPLMMLPTDIALKTDPAFRVWVDKYAADKDLFFDHFAKAFAKLMELGIKRDENDRVINADNVKGGYISAPKKSNHPTGPAKGAQGGCPVAASQGGCPRAKL | 
| Enzyme Length | 322 | 
| Uniprot Accession Number | Q4WLG9 | 
| Absorption | |
| Active Site | ACT_SITE 38; /note="Proton acceptor"; /evidence="ECO:0000255|PROSITE-ProRule:PRU00297, ECO:0000255|PROSITE-ProRule:PRU10012"; ACT_SITE 178; /note="Tryptophan radical intermediate"; /evidence="ECO:0000250" | 
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 1.11.1.- | 
| Enzyme Function | FUNCTION: Destroys radicals which are normally produced within the cells and which are toxic to biological systems. {ECO:0000250}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Metal binding (1); Region (1); Site (1) | 
| Keywords | Heme;Iron;Metal-binding;Oxidoreductase;Peroxidase;Reference proteome | 
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 35,032 | 
| Kinetics | |
| Metal Binding | METAL 162; /note=Iron (heme b axial ligand); /evidence=ECO:0000255|PROSITE-ProRule:PRU00297 | 
| Rhea ID | |
| Cross Reference Brenda |