| IED ID | IndEnz0018000305 |
| Enzyme Type ID | peroxidase000305 |
| Protein Name |
Aromatic peroxygenase AaP EC 1.11.2.1 |
| Gene Name | APO1 |
| Organism | Agrocybe aegerita (Black poplar mushroom) (Agaricus aegerita) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Strophariaceae Agrocybe Agrocybe aegerita (Black poplar mushroom) (Agaricus aegerita) |
| Enzyme Sequence | MKYFPLFPTLVFAARVVAFPAYASLAGLSQQELDAIIPTLEAREPGLPPGPLENSSAKLVNDEAHPWKPLRPGDIRGPCPGLNTLASHGYLPRNGVATPVQIINAVQEGLNFDNQAAVFATYAAHLVDGNLITDLLSIGRKTRLTGPDPPPPASVGGLNEHGTFEGDASMTRGDAFFGNNHDFNETLFEQLVDYSNRFGGGKYNLTVAGELRFKRIQDSIATNPNFSFVDFRFFTAYGETTFPANLFVDGRRDDGQLDMDAARSFFQFSRMPDDFFRAPSPRSGTGVEVVIQAHPMQPGRNVGKINSYTVDPTSSDFSTPCLMYEKFVNITVKSLYPNPTVQLRKALNTNLDFFFQGVAAGCTQVFPYGRD |
| Enzyme Length | 371 |
| Uniprot Accession Number | B9W4V6 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=RH + H(2)O(2) = ROH + H(2)O.; EC=1.11.2.1; |
| DNA Binding | |
| EC Number | 1.11.2.1 |
| Enzyme Function | FUNCTION: Aromatic peroxidase that oxidizes aryl alcohols into the corresponding aldehydes and then into the corresponding benzoic acids. Oxidizes toluene and naphthalene. Catalyzes the regioselective peroxide-dependent hydroxylation of propranolol and diclofenac to 5-hydroxypropranolol and 4'-hydroxydiclofenac. Catalyzes the regioselective peroxide-dependent hydroxylation of naphthalene to 1-naphthol or 2-naphthol via a naphthalene 1,2-oxide intermediate. Catalyzes the regioselective peroxide-dependent oxidation of pyridine to pyridine N-oxide. Halogenates monochlorodimedone and phenol. Oxidizes the sulfur-containing heterocycle dibenzothiophene to yield ring-hydroxylation products and to a lesser extent sulfoxidation products. {ECO:0000269|PubMed:15294788, ECO:0000269|PubMed:16253244, ECO:0000269|PubMed:17410351, ECO:0000269|PubMed:18815784, ECO:0000269|PubMed:19022254, ECO:0000269|PubMed:19039585, ECO:0000269|PubMed:19394224}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 4.7 with ABTS as substrate. Optimum pH is 7.2 with benzyl alcohol as substrate, and there is another optimum at pH 6.2. Optimum pH is 7.2 with dimethoxyphenol as substrate. Optimum pH is 6.0 with naphthalene as substrate. Optimum pH is 7.0 with pyridine as substrate. Optimum pH is 7.0 with veratryl alcohol as substrate, and there is another optimum at pH 5.5. {ECO:0000269|PubMed:15294788, ECO:0000269|PubMed:17410351, ECO:0000269|PubMed:19022254}; |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (6); Chain (1); Disulfide bond (1); Glycosylation (5); Helix (13); Metal binding (1); Propeptide (1); Sequence conflict (6); Signal peptide (1); Turn (3) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Glycoprotein;Heme;Hydrogen peroxide;Iron;Metal-binding;Oxidoreductase;Peroxidase;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: N-glycosylated. {ECO:0000269|PubMed:19434406}. |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (12) |
| Cross Reference PDB | 2YOR; 2YP1; 5OXT; 5OXU; 5OY1; 5OY2; 6EKW; 6EKX; 6EKY; 6EKZ; 6EL0; 6EL4; |
| Mapped Pubmed ID | 20516602; 24126915; 30376293; |
| Motif | |
| Gene Encoded By | |
| Mass | 40,652 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=37 uM for ABTS (at pH 4.5) {ECO:0000269|PubMed:15294788, ECO:0000269|PubMed:17410351, ECO:0000269|PubMed:19022254}; KM=1001 uM for benzyl alcohol (at pH 7) {ECO:0000269|PubMed:15294788, ECO:0000269|PubMed:17410351, ECO:0000269|PubMed:19022254}; KM=298 uM for dimethoxyphenol (at pH 7) {ECO:0000269|PubMed:15294788, ECO:0000269|PubMed:17410351, ECO:0000269|PubMed:19022254}; KM=1313 uM for hydrogen peroxide (at pH 7) {ECO:0000269|PubMed:15294788, ECO:0000269|PubMed:17410351, ECO:0000269|PubMed:19022254}; KM=320 uM for naphthalene (at pH 7) {ECO:0000269|PubMed:15294788, ECO:0000269|PubMed:17410351, ECO:0000269|PubMed:19022254}; KM=69 uM for pyridine (at pH 7) {ECO:0000269|PubMed:15294788, ECO:0000269|PubMed:17410351, ECO:0000269|PubMed:19022254}; KM=2367 uM for veratryl alcohol (at pH 7) {ECO:0000269|PubMed:15294788, ECO:0000269|PubMed:17410351, ECO:0000269|PubMed:19022254}; |
| Metal Binding | METAL 79; /note=Iron (heme axial ligand); /evidence=ECO:0000250|UniProtKB:P04963 |
| Rhea ID | |
| Cross Reference Brenda | 1.11.2.1; |