| IED ID | IndEnz0018000306 |
| Enzyme Type ID | peroxidase000306 |
| Protein Name |
Sodium/potassium-transporting ATPase subunit beta-1 Protein nervana 1 Sodium/potassium-dependent ATPase subunit beta-1 |
| Gene Name | nrv1 CG9258 |
| Organism | Drosophila melanogaster (Fruit fly) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Ephydroidea Drosophilidae (pomace flies) Drosophilinae Drosophilini Drosophila (fruit flies) Sophophora melanogaster group melanogaster subgroup Drosophila melanogaster (Fruit fly) |
| Enzyme Sequence | MSKNNGKGAKGEFEFPQPAKKQTFSEMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTICMQGLLSTISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIELIDDFLRDYNHTEGRDMKHCGFGQVLEPTDVCVVNTDLFGGCSKANNYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQGFPSYYYPFLNQPGYLSPLVAVQFNSPPKGQMLDVECRAWAKNIQYSGSVRDRKGSVTFQILLD |
| Enzyme Length | 309 |
| Uniprot Accession Number | Q24046 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. {ECO:0000269|PubMed:9648860}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Glycosylation (2); Sequence conflict (4); Topological domain (2); Transmembrane (1) |
| Keywords | Cell membrane;Disulfide bond;Glycoprotein;Ion transport;Membrane;Potassium;Potassium transport;Reference proteome;Signal-anchor;Sodium;Sodium transport;Sodium/potassium transport;Transmembrane;Transmembrane helix;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10452950; 10470487; 11691629; 11719513; 12532273; 12695332; 12765609; 12769954; 12782686; 12930776; 15131112; 15299033; 15345053; 15501232; 15833123; 15861189; 15976174; 17164420; 17278125; 17625558; 17998402; 18054857; 19000835; 19036722; 19087263; 19189950; 20336468; 20371351; 20462449; 20624714; 21074052; 21480662; 21781960; 23056407; 23071443; 23236268; 23248276; 23895496; 23970418; 25186133; 25205229; 25294944; 25312911; 25452710; 25524989; 25715730; 25834215; 26231660; 26994946; 27064297; 27250760; 27582081; 27794539; 28395731; 28428068; 29369778; 29987037; 30635267; 31068592; 31959160; 32630420; 3320283; 33262246; 34379632; 6806816; 9751137; |
| Motif | |
| Gene Encoded By | |
| Mass | 35,309 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |