| IED ID | IndEnz0018000331 |
| Enzyme Type ID | peroxidase000331 |
| Protein Name |
Rhomboid protein 1, mitochondrial EC 3.4.21.105 Mitochondrial distribution and morphology protein 37 Processing of cytochrome c peroxidase protein 1 |
| Gene Name | PCP1 MDM37 RBD1 UGO2 YGR101W |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Enzyme Sequence | MSGVSSVMLGLRPATRIFFRSNISVSPSRTFVSYIGRSQSTSILKNAPNLEDNVTNLQKIIPKRFFSQTSILKSRWKPIFNEETTNRYVRLNRFQQYQQQRSGGNPLGSMTILGLSLMAGIYFGSPYLFEHVPPFTYFKTHPKNLVYALLGINVAVFGLWQLPKCWRFLQKYMLLQKDYVTSKISIIGSAFSHQEFWHLGMNMLALWSFGTSLATMLGASNFFSLYMNSAIAGSLFSLWYPKLARLAIVGPSLGASGALFGVLGCFSYLFPHAKILLFVFPVPGGAWVAFLASVAWNAAGCALRWGSFDYAAHLGGSMMGVLYGWYISKAVEKQRQRRLQAAGRWF |
| Enzyme Length | 346 |
| Uniprot Accession Number | P53259 |
| Absorption | |
| Active Site | ACT_SITE 256; /note=Nucleophile; ACT_SITE 313 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleaves type-1 transmembrane domains using a catalytic dyad composed of serine and histidine that are contributed by different transmembrane domains.; EC=3.4.21.105; |
| DNA Binding | |
| EC Number | 3.4.21.105 |
| Enzyme Function | FUNCTION: Mitochondrial rhomboid serine protease processing the mitochondrial membrane fusion regulator MGM1, and the cytochrome c peroxidase (CCP1). Required for TIM11 stability, ATP synthase complex assembly, mitochondrial morphology, cytochrome c (CYC1) storage and mitochondrial genome maintenance. {ECO:0000269|PubMed:11907266, ECO:0000269|PubMed:12417197, ECO:0000269|PubMed:12707284, ECO:0000269|PubMed:12774122, ECO:0000269|PubMed:12901865, ECO:0000269|PubMed:15125685}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Mutagenesis (5); Transit peptide (1); Transmembrane (6) |
| Keywords | Hydrolase;Membrane;Mitochondrion;Mitochondrion inner membrane;Protease;Reference proteome;Serine protease;Transit peptide;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000269|PubMed:12774122, ECO:0000269|PubMed:12901865, ECO:0000269|PubMed:14562095}; Multi-pass membrane protein {ECO:0000269|PubMed:12774122, ECO:0000269|PubMed:12901865, ECO:0000269|PubMed:14562095}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12134146; 12791261; 15096522; 15979251; 16571363; 16725216; 16754953; 16778770; 17245427; 17263664; 17362197; 17445721; 17615298; 18604275; 18605900; 19019989; 19453275; 20045481; 20558178; 21299651; 21912603; 21936845; 22001671; 22658600; 22748693; 22808334; 24007978; 24099009; 24648523; 27502471; 27693354; |
| Motif | |
| Gene Encoded By | |
| Mass | 38,815 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.105; |