| IED ID | IndEnz0018000359 |
| Enzyme Type ID | peroxidase000359 |
| Protein Name |
Peroxiredoxin OsmC EC 1.11.1.- Osmotically-inducible protein C |
| Gene Name | osmC b1482 JW1477 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLKS |
| Enzyme Length | 143 |
| Uniprot Accession Number | P0C0L2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[protein]-dithiol + a hydroperoxide = [protein]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:10008, Rhea:RHEA-COMP:10593, Rhea:RHEA-COMP:10594, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; |
| DNA Binding | |
| EC Number | 1.11.1.- |
| Enzyme Function | FUNCTION: Preferentially metabolizes organic hydroperoxides over inorganic hydrogen peroxide. {ECO:0000269|PubMed:14627744}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (7); Chain (1); Compositional bias (1); Helix (4); Initiator methionine (1); Modified residue (1); Region (1) |
| Keywords | 3D-structure;Acetylation;Antioxidant;Cytoplasm;Direct protein sequencing;Oxidoreductase;Peroxidase;Reference proteome |
| Interact With | |
| Induction | INDUCTION: By elevated osmotic pressure in the growth medium. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. |
| Modified Residue | MOD_RES 16; /note=N6-acetyllysine; /evidence=ECO:0000269|PubMed:18723842 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 1NYE; 1QWI; |
| Mapped Pubmed ID | 16606699; 24561554; |
| Motif | |
| Gene Encoded By | |
| Mass | 15,088 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:10008 |
| Cross Reference Brenda |