Detail Information for IndEnz0018000377
IED ID IndEnz0018000377
Enzyme Type ID peroxidase000377
Protein Name Putative peroxiredoxin-A
EC 1.11.1.24
PMP20
Peroxisomal membrane protein A
Thioredoxin reductase
Thioredoxin-dependent peroxiredoxin-A
allergen Cand b 2
Gene Name PMPA
Organism Candida boidinii (Yeast)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Pichiaceae Ogataea Ogataea/Candida clade Candida boidinii (Yeast)
Enzyme Sequence MAPIKRGDRFPTTDDVYYIPPEGGEPGPLELSKFVKTKKFVVVSVPGAFTPPCTEQHLPGYIKNLPRILSKGVDFVLVISQNDPFVLKGWKKELGAADAKKLVFVSDPNLKLTKKLGSTIDLSAIGLGTRSGRLALIVNRSGIVEYAAIENGGEVDVSTAQKIIAKL
Enzyme Length 167
Uniprot Accession Number P14292
Absorption
Active Site ACT_SITE 53; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:P38013
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000250|UniProtKB:P38013};
DNA Binding
EC Number 1.11.1.24
Enzyme Function FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. {ECO:0000250|UniProtKB:P38013}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Active site (1); Chain (1); Domain (1); Initiator methionine (1); Motif (1)
Keywords Allergen;Antioxidant;Direct protein sequencing;Membrane;Methanol utilization;Oxidoreductase;Peroxidase;Peroxisome;Redox-active center
Interact With
Induction INDUCTION: By methanol. {ECO:0000269|PubMed:2760051}.
Subcellular Location SUBCELLULAR LOCATION: Peroxisome membrane; Peripheral membrane protein {ECO:0000269|PubMed:2760051}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif MOTIF 165..167; /note=Microbody targeting signal
Gene Encoded By
Mass 18,004
Kinetics
Metal Binding
Rhea ID RHEA:62620
Cross Reference Brenda