| IED ID | IndEnz0018000454 |
| Enzyme Type ID | peroxidase000454 |
| Protein Name |
Glutathione S-transferase F10 AtGSTF10 EC 2.5.1.18 AtGSTF4 GST class-phi member 10 Protein EARLY RESPONSE TO DEHYDRATION 13 |
| Gene Name | GSTF10 ERD13 GSTF4 At2g30870 F7F1.8 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MVLTIYAPLFASSKRAVVTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFESRAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPADEKVIKESEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVGPIGKAHLIKDRKHVSAWWDKISSRAAWKEVSAKYSLPV |
| Enzyme Length | 215 |
| Uniprot Accession Number | P42761 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=glutathione + RX = a halide anion + an S-substituted glutathione + H(+); Xref=Rhea:RHEA:16437, ChEBI:CHEBI:15378, ChEBI:CHEBI:16042, ChEBI:CHEBI:17792, ChEBI:CHEBI:57925, ChEBI:CHEBI:90779; EC=2.5.1.18; Evidence={ECO:0000269|PubMed:12090627}; |
| DNA Binding | |
| EC Number | 2.5.1.18 |
| Enzyme Function | FUNCTION: In vitro, possesses glutathione S-transferase activity toward 1-chloro-2,4-dinitrobenzene (CDNB) and benzyl isothiocyanate (BITC). May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides. {ECO:0000269|PubMed:12090627}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (2); Initiator methionine (1); Region (4) |
| Keywords | Cytoplasm;Detoxification;Direct protein sequencing;Reference proteome;Stress response;Transferase |
| Interact With | |
| Induction | INDUCTION: By dehydration stress, wounding, H(2)O(2) and jasmonate, but not by growth regulators. {ECO:0000269|PubMed:12207667, ECO:0000269|PubMed:19118534}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10785664; 12102506; 14500793; 14558660; 15159623; 15539469; 15618427; 16005291; 16055689; 16088002; 16199612; 16287169; 16502469; 16526091; 16679420; 16980540; 17376161; 17644812; 17828791; 18431481; 18467450; 18467456; 18538804; 18854047; 19067976; 20018591; 20442276; 21146842; 22633844; 23083132; 23661340; 28627464; 8075396; 9545564; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,230 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16437 |
| Cross Reference Brenda |