| IED ID | IndEnz0018000461 |
| Enzyme Type ID | peroxidase000461 |
| Protein Name |
Microsomal glutathione S-transferase 3 Microsomal GST-3 Glutathione peroxidase MGST3 EC 1.11.1.- Microsomal glutathione S-transferase III Microsomal GST-III |
| Gene Name | Mgst3 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MAVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPENGHMFNCIQRAHQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIIGRVLYAYGYYTGDPSKRYRGAVGSLALFALMGTTVCSAFQHLGWIRPGLGYGSRSCHH |
| Enzyme Length | 153 |
| Uniprot Accession Number | Q9CPU4 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by MK-886 and leukotriene C4. {ECO:0000250|UniProtKB:D4ADS4}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=(5S)-hydroperoxy-(6E,8Z,11Z,14Z)-eicosatetraenoate + 2 glutathione = (5S)-hydroxy-(6E,8Z,11Z,14Z)-eicosatetraenoate + glutathione disulfide + H2O; Xref=Rhea:RHEA:48620, ChEBI:CHEBI:15377, ChEBI:CHEBI:57450, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297, ChEBI:CHEBI:90632; Evidence={ECO:0000250|UniProtKB:O14880}; |
| DNA Binding | |
| EC Number | 1.11.1.- |
| Enzyme Function | FUNCTION: Catalyzes oxydation of hydroxy-fatty acids. May participate to the lipid metabolism. {ECO:0000250|UniProtKB:O14880}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Lipidation (1); Sequence conflict (1); Transmembrane (3) |
| Keywords | Direct protein sequencing;Endoplasmic reticulum;Lipid metabolism;Lipoprotein;Membrane;Microsome;Oxidoreductase;Palmitate;Reference proteome;Transferase;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:O14880}; Multi-pass membrane protein {ECO:0000250|UniProtKB:O14880}. Microsome membrane {ECO:0000250|UniProtKB:O14880}; Multi-pass membrane protein {ECO:0000250|UniProtKB:O14880}. Microsome membrane {ECO:0000250|UniProtKB:O14880}; Lipid-anchor {ECO:0000250|UniProtKB:O14880}. Membrane {ECO:0000250|UniProtKB:O14880}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 12466851; 14610273; 14681479; 15520881; 15597075; 18554416; 18614564; 21267068; 21677750; 22323595; 24154525; 24952961; 25556833; 27626380; 27689697; 32732898; |
| Motif | |
| Gene Encoded By | |
| Mass | 16,958 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:48620 |
| Cross Reference Brenda |