| IED ID | IndEnz0018000525 |
| Enzyme Type ID | peroxidase000525 |
| Protein Name |
Glutaredoxin-1 Glutathione-dependent oxidoreductase 1 |
| Gene Name | GRX1 GLOINDRAFT_350295 |
| Organism | Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) (Arbuscular mycorrhizal fungus) (Glomus intraradices) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Fungi incertae sedis Mucoromycota Glomeromycotina Glomeromycetes Glomerales Glomeraceae Rhizophagus Rhizophagus irregularis Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) (Arbuscular mycorrhizal fungus) (Glomus intraradices) |
| Enzyme Sequence | MSQIKDRVEKLIQTNPVMMFSKSFCPYCKKAKATLKELNVEPGICELDEDSEGRAIQDYLKEKTSQNTVPNIFIKGQHVGGCDDLLAAKDNGSLSKMIAAL |
| Enzyme Length | 101 |
| Uniprot Accession Number | B7ZFT1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Multifunctional enzyme with glutathione-dependent oxidoreductase, glutathione peroxidase and glutathione S-transferase (GST) activity. The disulfide bond functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. In addition, it is also involved in reducing cytosolic protein- and non-protein-disulfides in a coupled system with glutathione reductase. May play a role in protection against oxidative stress caused by superoxide in vivo by regulating the redox state of the protein sulfhydryl groups. {ECO:0000250|UniProtKB:P68688, ECO:0000269|PubMed:18955149, ECO:0000303|PubMed:18955149}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Domain (1); Erroneous gene model prediction (1); Sequence conflict (1) |
| Keywords | Cytoplasm;Disulfide bond;Electron transport;Redox-active center;Transport |
| Interact With | |
| Induction | INDUCTION: Up-regulation of expression first detected at 24 hours after exposure to copper and reaches to a maximum after 7 days. Up-regulation of expression reaches to a maximum at 12 hours after exposure to paraquat and returns to basal levels within 24 hours. {ECO:0000269|PubMed:18955149}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000269|PubMed:18955149}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 11,180 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |