| IED ID | IndEnz0018000531 | 
| Enzyme Type ID | peroxidase000531 | 
| Protein Name | 
                        
                            
                                Glutathione S-transferase 3  EC 2.5.1.18 GST class-alpha GST-CL3  | 
                    
| Gene Name | |
| Organism | Gallus gallus (Chicken) | 
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae (turkeys) Phasianinae Gallus Gallus gallus (Chicken) | 
| Enzyme Sequence | MAAKPVLYYFNGRGKMESIRWLLAAAGVEFEEVFLETREQYEKLLQSGILMFQQVPMVEIDGMKLVQTRAILNYIAGKYNLYGKDLKERALIDMYVGGTDDLMGFLLSFPFLSAEDKVKQCAFVVEKATSRYFPAYEKVLKDHGQDFLVGNRLSWADIHLLEAILMVEEKKSDALSGFPLLQAFKKRISSIPTIKKFLAPGSKRKPISDDKYVETVRRVLRMYYDVKPH | 
| Enzyme Length | 229 | 
| Uniprot Accession Number | P26697 | 
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 9; /note="Glutathione"; /evidence="ECO:0007744|PDB:1VF1, ECO:0007744|PDB:1VF2, ECO:0007744|PDB:1VF3" | 
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=glutathione + RX = a halide anion + an S-substituted glutathione + H(+); Xref=Rhea:RHEA:16437, ChEBI:CHEBI:15378, ChEBI:CHEBI:16042, ChEBI:CHEBI:17792, ChEBI:CHEBI:57925, ChEBI:CHEBI:90779; EC=2.5.1.18; Evidence={ECO:0000250|UniProtKB:Q16772};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:16438; Evidence={ECO:0000250|UniProtKB:Q16772}; | 
| DNA Binding | |
| EC Number | 2.5.1.18 | 
| Enzyme Function | FUNCTION: Catalyzes the conjugation of GSH to a wide variety of electrophilic alkylating agents. Also involved in the metabolism of lipid hydroperoxides, prostaglandins and leukotriene A4 and in binding of non-substrate hydrophobic ligands such as bile acids, a number of drugs and thyroid hormones. This GST does not exhibit peroxidase activity. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Binding site (1); Chain (1); Domain (2); Helix (11); Initiator methionine (1); Modified residue (1); Natural variant (12); Region (2); Turn (3) | 
| Keywords | 3D-structure;Cytoplasm;Direct protein sequencing;Reference proteome;Transferase | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. | 
| Modified Residue | MOD_RES 2; /note=Blocked amino end (Ala) | 
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (4) | 
| Cross Reference PDB | 1VF1; 1VF2; 1VF3; 1VF4; | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 26,326 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16437; RHEA:16438 | 
| Cross Reference Brenda |