| IED ID | IndEnz0018000533 |
| Enzyme Type ID | peroxidase000533 |
| Protein Name |
Glutathione S-transferase A4 EC 2.5.1.18 GST A4-4 GSTA4-4 GST class-alpha member 4 Glutathione S-transferase 5.7 GST 5.7 |
| Gene Name | Gsta4 Gsta |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQKDGHLLFGQVPLVEIDGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIAVAPFKTPKEKEESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMVEELSAPVLSDFPLLQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRTVLKF |
| Enzyme Length | 222 |
| Uniprot Accession Number | P24472 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 9; /note=Glutathione; /evidence=ECO:0000250|UniProtKB:P13745 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=glutathione + RX = a halide anion + an S-substituted glutathione + H(+); Xref=Rhea:RHEA:16437, ChEBI:CHEBI:15378, ChEBI:CHEBI:16042, ChEBI:CHEBI:17792, ChEBI:CHEBI:57925, ChEBI:CHEBI:90779; EC=2.5.1.18; Evidence={ECO:0000269|PubMed:10508391}; |
| DNA Binding | |
| EC Number | 2.5.1.18 |
| Enzyme Function | FUNCTION: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. {ECO:0000269|PubMed:10508391}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (7); Binding site (1); Chain (1); Domain (2); Helix (12); Modified residue (1); Natural variant (3); Region (2); Sequence conflict (3); Turn (2) |
| Keywords | 3D-structure;Acetylation;Cytoplasm;Direct protein sequencing;Reference proteome;Transferase |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. |
| Modified Residue | MOD_RES 1; /note=N-acetylmethionine; /evidence=ECO:0000250|UniProtKB:P14942 |
| Post Translational Modification | PTM: The N-terminus is blocked. |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 1B48; 1GUK; |
| Mapped Pubmed ID | 11217851; 11326268; 11851347; 11884396; 12020353; 12466851; 12646569; 12904583; 14595844; 14610273; 14681479; 14761685; 15629866; 15831471; 16223495; 16325481; 16466397; 18311940; 18799693; 18930016; 18973680; 19482077; 19880816; 20150287; 20404090; 20832906; 20966433; 21267068; 22038048; 22323595; 22711583; 22881716; 23690225; 25501545; 26010708; 26654979; 27065323; 27133129; 27626380; 27998724; 29127112; 29708596; 31515474; 32044382; 7904605; 9806360; |
| Motif | |
| Gene Encoded By | |
| Mass | 25,564 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16437 |
| Cross Reference Brenda | 2.5.1.18; |