| IED ID | IndEnz0018000542 | 
| Enzyme Type ID | peroxidase000542 | 
| Protein Name | 
                        
                            
                                Glutathione peroxidase 1, mitochondrial  CrGPx1 EC 1.11.1.9  | 
                    
| Gene Name | GPX PHGPX1 CHLREDRAFT_206090 | 
| Organism | Chlamydomonas reinhardtii (Chlamydomonas smithii) | 
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Chlorophyta core chlorophytes Chlorophyceae CS clade Chlamydomonadales Chlamydomonadaceae Chlamydomonas Chlamydomonas reinhardtii (Chlamydomonas smithii) | 
| Enzyme Sequence | MLLTRKNVAVRPARAARRDVRAMSLLGNLFGGGSKPTSSTSNFHQLSALDIDKKNVDFKSLNNRVVLVVNVASKUGLTAANYKEFATLLGKYPATDLTIVAFPCNQFGGQEPGTNAEIKAFASARGFSGAGALLMDKVDVNGANASPVYNFLKVAAGDTSDIGWNFGKFLVRPDGTVFGRYAPTTGPLSLEKYIVELINSR | 
| Enzyme Length | 201 | 
| Uniprot Accession Number | P83564 | 
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=2 glutathione + H2O2 = glutathione disulfide + 2 H2O; Xref=Rhea:RHEA:16833, ChEBI:CHEBI:15377, ChEBI:CHEBI:16240, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297; EC=1.11.1.9; Evidence={ECO:0000269|PubMed:11973339}; | 
| DNA Binding | |
| EC Number | 1.11.1.9 | 
| Enzyme Function | FUNCTION: May constitute a glutathione peroxidase-like protective system against oxidative stresses. Hydrogen peroxide, tert-butyl hydroperoxide and cumene, but not phosphatidylcholine hydroperoxide, can act as acceptors. {ECO:0000269|PubMed:11973339}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-standard residue (1); Transit peptide (1) | 
| Keywords | Mitochondrion;Oxidoreductase;Peroxidase;Selenium;Selenocysteine;Transit peptide | 
| Interact With | |
| Induction | INDUCTION: By selenium, particularly under autotrophic conditions. {ECO:0000269|PubMed:11973339}. | 
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000305}. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 21,499 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16833 | 
| Cross Reference Brenda |