| IED ID | IndEnz0018000605 |
| Enzyme Type ID | peroxidase000605 |
| Protein Name |
Peroxidase 3 EC 1.11.1.7 Fragments |
| Gene Name | |
| Organism | Vitis vinifera (Grape) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids rosids incertae sedis Vitales Vitaceae Viteae Vitis Vitis vinifera (Grape) |
| Enzyme Sequence | QTFVTIPGTLRDHPDNLSLAGDGFDTVIKVSCADILTMATR |
| Enzyme Length | 41 |
| Uniprot Accession Number | P86015 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=2 a phenolic donor + H2O2 = 2 a phenolic radical donor + 2 H2O; Xref=Rhea:RHEA:56136, ChEBI:CHEBI:15377, ChEBI:CHEBI:16240, ChEBI:CHEBI:139520, ChEBI:CHEBI:139521; EC=1.11.1.7; |
| DNA Binding | |
| EC Number | 1.11.1.7 |
| Enzyme Function | FUNCTION: Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue. {ECO:0000305}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (2); Non-terminal residue (2); Sequence uncertainty (11) |
| Keywords | Calcium;Direct protein sequencing;Heme;Hydrogen peroxide;Iron;Metal-binding;Oxidoreductase;Peroxidase;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P84516, ECO:0000255|PROSITE-ProRule:PRU00297}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 4,391 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:56136 |
| Cross Reference Brenda |