| IED ID | IndEnz0018000725 |
| Enzyme Type ID | peroxidase000725 |
| Protein Name |
Peroxidase EC 1.11.1.7 Fragments |
| Gene Name | |
| Organism | Ginkgo biloba (Ginkgo) (Maidenhair tree) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Acrogymnospermae Ginkgoopsida Ginkgoidae Ginkgoales Ginkgoaceae Ginkgo Ginkgo biloba (Ginkgo) (Maidenhair tree) |
| Enzyme Sequence | LSPTFYATSXPNVXXTRDSVVEIGQLADTVAPVRGFDVIDNIKDMVALSGSHTIGQARQATRSPAQVDLSNTRGLLGQAGNDFALVDDK |
| Enzyme Length | 89 |
| Uniprot Accession Number | P85317 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=2 a phenolic donor + H2O2 = 2 a phenolic radical donor + 2 H2O; Xref=Rhea:RHEA:56136, ChEBI:CHEBI:15377, ChEBI:CHEBI:16240, ChEBI:CHEBI:139520, ChEBI:CHEBI:139521; EC=1.11.1.7; Evidence={ECO:0000269|PubMed:19055540}; |
| DNA Binding | |
| EC Number | 1.11.1.7 |
| Enzyme Function | FUNCTION: Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue. Active against p-coumaryl alcohol, coniferyl alcohol and coniferyl aldehyde. {ECO:0000255|PROSITE-ProRule:PRU00297, ECO:0000269|PubMed:19055540}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Metal binding (3); Non-adjacent residues (8); Non-terminal residue (1); Sequence uncertainty (8) |
| Keywords | Calcium;Direct protein sequencing;Heme;Hydrogen peroxide;Iron;Metal-binding;Oxidoreductase;Peroxidase;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P84516, ECO:0000255|PROSITE-ProRule:PRU00297}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,406 |
| Kinetics | |
| Metal Binding | METAL 52; /note="Iron (heme axial ligand)"; /evidence="ECO:0000250|UniProtKB:Q39034, ECO:0000255|PROSITE-ProRule:PRU00297"; METAL 53; /note="Calcium 2"; /evidence="ECO:0000250|UniProtKB:Q39034, ECO:0000255|PROSITE-ProRule:PRU00297"; METAL 68; /note="Calcium 2"; /evidence="ECO:0000250|UniProtKB:Q39034, ECO:0000255|PROSITE-ProRule:PRU00297" |
| Rhea ID | RHEA:56136 |
| Cross Reference Brenda |