| IED ID | IndEnz0018000731 |
| Enzyme Type ID | peroxidase000731 |
| Protein Name |
Eosinophil cationic protein ECP EC 3.1.27.- Ribonuclease 3 RNase 3 |
| Gene Name | RNASE3 ECP RNS3 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI |
| Enzyme Length | 160 |
| Uniprot Accession Number | P12724 |
| Absorption | |
| Active Site | ACT_SITE 42; /note=Proton acceptor; ACT_SITE 155; /note=Proton donor |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.27.- |
| Enzyme Function | FUNCTION: Cytotoxin and helminthotoxin with low-efficiency ribonuclease activity. Possesses a wide variety of biological activities. Exhibits antibacterial activity, including cytoplasmic membrane depolarization of preferentially Gram-negative, but also Gram-positive strains. Promotes E.coli outer membrane detachment, alteration of the overall cell shape and partial loss of cell content. {ECO:0000269|PubMed:19450231, ECO:0000269|PubMed:2501794}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (9); Chain (1); Disulfide bond (4); Glycosylation (3); Helix (5); Modified residue (1); Mutagenesis (1); Natural variant (3); Region (2); Signal peptide (1); Site (2); Turn (2) |
| Keywords | 3D-structure;Antibiotic;Antimicrobial;Direct protein sequencing;Disulfide bond;Endonuclease;Glycoprotein;Hydrolase;Nitration;Nuclease;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. Note=Located in the matrix of eosinophil large specific granule, which are released following activation by an immune stimulus. |
| Modified Residue | MOD_RES 60; /note=3'-nitrotyrosine; /evidence=ECO:0000269|PubMed:18694936 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..27; /evidence="ECO:0000269|PubMed:2501794, ECO:0000269|PubMed:3458170" |
| Structure 3D | X-ray crystallography (9); NMR spectroscopy (2) |
| Cross Reference PDB | 1DYT; 1H1H; 1QMT; 2KB5; 2LVZ; 4A2O; 4A2Y; 4OWZ; 4OXB; 4OXF; 4X08; |
| Mapped Pubmed ID | 11959927; 12100059; 12524255; 12530121; 12974194; 14630983; 15007353; 15295703; 15317478; 15928844; 16010966; 16014847; 16874959; 16879306; 16883790; 16940129; 17088327; 17223693; 17250693; 17362255; 17507019; 17573858; 17587163; 17675527; 17726151; 17804567; 17852809; 17927842; 17944807; 18087674; 18293932; 18345486; 18593710; 18657051; 18673279; 18716399; 19014520; 19086659; 19133919; 19189375; 19284504; 19366593; 19476022; 19521893; 19542456; 19566743; 19639743; 19692640; 19717523; 19760211; 20089176; 20170318; 20180804; 20307883; 20523065; 20534163; 20951760; 21038779; 21183182; 21303303; 21878071; 21962901; 22216286; 22289536; 22327069; 22579681; 22845717; 22845733; 23025322; 23135272; 23197886; 23302724; 23406588; 23430080; 23484086; 23517396; 23597768; 23710948; 23716047; 23786280; 24129707; 24383969; 24738159; 24814827; 25075772; 25354326; 25463127; 26600485; 27022611; 27087278; 27089320; 27696685; 28781336; 28904229; 29066479; 29402293; 30845981; 31327190; 32442701; 32761877; 33113080; 33226440; 8692836; |
| Motif | |
| Gene Encoded By | |
| Mass | 18,385 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |