| IED ID | IndEnz0018000733 |
| Enzyme Type ID | peroxidase000733 |
| Protein Name |
Glutaredoxin-C6 Glutaredoxin-C2 homolog 1 |
| Gene Name | GRXC6 RASC8 Os04g0508300 LOC_Os04g42930 OsJ_15409 OSJNBa0043L24.17 |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice) |
| Enzyme Sequence | MALAKAKETVASAPVVVYSKSYCPFCVRVKKLFEQLGATFKAIELDGESDGSELQSALAEWTGQRTVPNVFINGKHIGGCDDTLALNNEGKLVPLLTEAGAIASSAKTTITA |
| Enzyme Length | 112 |
| Uniprot Accession Number | P55142 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins. Possesses thioltransferase, dehydroascorbate reductase and GSH-dependent peroxidase activities in vitro. {ECO:0000269|PubMed:12207894, ECO:0000269|PubMed:8287970}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Domain (1); Mutagenesis (1); Sequence conflict (1) |
| Keywords | Cytoplasm;Direct protein sequencing;Disulfide bond;Electron transport;Redox-active center;Reference proteome;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | PTM: The N-terminus is blocked. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12626113; 15618434; 16883479; 16915354; 17031546; 18996570; 19825559; 19825617; 20333196; 21044985; 22319054; 23138651; 23638363; 23918184; 25541357; 25781542; 25845722; 26126957; 26579177; 26606179; 27208278; |
| Motif | |
| Gene Encoded By | |
| Mass | 11,774 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=0.58 mM for H(2)O(2) {ECO:0000269|PubMed:12207894}; KM=0.29 mM for cumene hydroperoxide {ECO:0000269|PubMed:12207894}; KM=0.31 mM for tert-butyl hydroperoxide {ECO:0000269|PubMed:12207894}; Vmax=62.5 umol/min/mg enzyme for H(2)O(2) {ECO:0000269|PubMed:12207894}; Vmax=38.5 umol/min/mg enzyme for cumene hydroperoxide {ECO:0000269|PubMed:12207894}; Vmax=16.8 umol/min/mg enzyme for tert-butyl hydroperoxide {ECO:0000269|PubMed:12207894}; Note=The highest catalytic efficiency is observed with cumene hydroperoxide as substrate.; |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |