| IED ID | IndEnz0018000734 |
| Enzyme Type ID | peroxidase000734 |
| Protein Name |
Glutathione S-transferase 1 EC 2.5.1.18 GST class-sigma |
| Gene Name | GST1 |
| Organism | Ascaris suum (Pig roundworm) (Ascaris lumbricoides) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Spirurina Ascaridomorpha Ascaridoidea Ascarididae Ascaris Ascaris suum (Pig roundworm) (Ascaris lumbricoides) |
| Enzyme Sequence | MPQYKLTYFDIRGLGEGARLIFHQAGVKFEDNRLKREDWPALKPKTPFGQLPLLEVDGEVLAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAELRPCFRVLAGFEEGDKEKVLKEVAVPARDKHLPLLEKFLAKSGSEYMVGKSVTWADLVITDSLASWESLIPDFLSGHLQLKKYIEHVRELPNIKKWIAERPKTPY |
| Enzyme Length | 206 |
| Uniprot Accession Number | P46436 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 8; /note=Glutathione; /evidence=ECO:0000250|UniProtKB:O60760; BINDING 39; /note=Glutathione; /evidence=ECO:0000250|UniProtKB:O60760; BINDING 43; /note=Glutathione; /evidence=ECO:0000250|UniProtKB:P46088 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=glutathione + RX = a halide anion + an S-substituted glutathione + H(+); Xref=Rhea:RHEA:16437, ChEBI:CHEBI:15378, ChEBI:CHEBI:16042, ChEBI:CHEBI:17792, ChEBI:CHEBI:57925, ChEBI:CHEBI:90779; EC=2.5.1.18; |
| DNA Binding | |
| EC Number | 2.5.1.18 |
| Enzyme Function | FUNCTION: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Can also function as a GSH peroxidase. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (6); Binding site (3); Chain (1); Domain (2); Helix (13); Initiator methionine (1); Region (2); Turn (2) |
| Keywords | 3D-structure;Direct protein sequencing;Transferase |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 4Q5F; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 23,585 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16437 |
| Cross Reference Brenda | 2.5.1.18; |