| IED ID | IndEnz0018000736 |
| Enzyme Type ID | peroxidase000736 |
| Protein Name |
Glutathione S-transferase Mu 2 EC 2.5.1.18 GST class-mu 2 GSTM2-2 |
| Gene Name | GSTM2 GST4 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK |
| Enzyme Length | 218 |
| Uniprot Accession Number | P28161 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 50; /note=Glutathione; /evidence=ECO:0000250|UniProtKB:P08010; BINDING 116; /note=Substrate; /evidence=ECO:0000250 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=glutathione + RX = a halide anion + an S-substituted glutathione + H(+); Xref=Rhea:RHEA:16437, ChEBI:CHEBI:15378, ChEBI:CHEBI:16042, ChEBI:CHEBI:17792, ChEBI:CHEBI:57925, ChEBI:CHEBI:90779; EC=2.5.1.18; Evidence={ECO:0000269|PubMed:16549767};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:16438; Evidence={ECO:0000305|PubMed:16549767}; CATALYTIC ACTIVITY: Reaction=11(S)-hydroxy-14(S),15(S)-epoxy-(5Z,8Z,12E)-eicosatrienoate + glutathione = (11S,15S)-dihydroxy-14(R)-S-glutathionyl-(5Z,8Z,12E)-eicosatrienoate; Xref=Rhea:RHEA:50260, ChEBI:CHEBI:57925, ChEBI:CHEBI:132200, ChEBI:CHEBI:132201; Evidence={ECO:0000269|PubMed:21046276};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:50261; Evidence={ECO:0000305|PubMed:21046276}; |
| DNA Binding | |
| EC Number | 2.5.1.18 |
| Enzyme Function | FUNCTION: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Participates in the formation of novel hepoxilin regioisomers (PubMed:21046276). {ECO:0000269|PubMed:16549767, ECO:0000269|PubMed:21046276}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Beta strand (8); Binding site (2); Chain (1); Domain (2); Helix (9); Modified residue (2); Mutagenesis (1); Natural variant (1); Region (4); Sequence conflict (3); Site (1); Turn (4) |
| Keywords | 3D-structure;Alternative splicing;Cytoplasm;Direct protein sequencing;Lipid metabolism;Phosphoprotein;Reference proteome;Transferase |
| Interact With | P46439 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. |
| Modified Residue | MOD_RES 27; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P08010; MOD_RES 44; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P08010 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (11) |
| Cross Reference PDB | 1HNA; 1HNB; 1HNC; 1XW5; 1YKC; 2AB6; 2C4J; 2GTU; 3GTU; 3GUR; 5HWL; |
| Mapped Pubmed ID | 10329152; 10587441; 10652317; 10783391; 11327815; 12042665; 12211029; 12486119; 12627223; 12871945; 14634838; 15725629; 16002077; 16081649; 16298388; 16548513; 17197702; 18007994; 18065725; 18308613; 18510611; 18551009; 19151192; 19168034; 19343046; 19696791; 19856098; 19859803; 19913121; 20083122; 20085333; 20200426; 20417188; 20485444; 20628086; 21106529; 21246532; 21268265; 21454564; 21455499; 21668448; 22522127; 23675469; 24399650; 24852519; 24965446; 27566576; 32574561; 33555546; 8203914; 8331657; 8431482; 9551553; 9761928; 9839448; |
| Motif | |
| Gene Encoded By | |
| Mass | 25,745 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16437; RHEA:16438; RHEA:50260; RHEA:50261 |
| Cross Reference Brenda | 2.5.1.18; |