| IED ID | IndEnz0018000750 |
| Enzyme Type ID | peroxidase000750 |
| Protein Name |
Thioredoxin-like protein Clot Thioredoxin Clot OsClot |
| Gene Name | Os06g0320000 LOC_Os06g21550 OsJ_21152 P0592B08.32 |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice) |
| Enzyme Sequence | MTVEKVDATVADFDAHFDKLFAAGDDAEGKVKLLLFLADRDASSNQTWCPDCNVAEPVIYDRVEAAAKGKEKDVVLLRAYVGDKPTWRDPAHPWRADPRFRLTGVPTLIRWENGAAAARLGDDEAHLADKVDAVVNAAN |
| Enzyme Length | 139 |
| Uniprot Accession Number | Q5Z9Z3 |
| Absorption | |
| Active Site | ACT_SITE 49; /note=Nucleophile; /evidence=ECO:0000255; ACT_SITE 52; /note=Nucleophile; /evidence=ECO:0000255 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Probable thiol-disulfide oxidoreductase that may participate in various redox reactions. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (1); Domain (1) |
| Keywords | Disulfide bond;Electron transport;Redox-active center;Reference proteome;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 15,232 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |