| IED ID | IndEnz0018000774 |
| Enzyme Type ID | peroxidase000774 |
| Protein Name |
Dye-decolorizing peroxidase DyP EC 1.11.1.7 |
| Gene Name | MAP_0631c |
| Organism | Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) (Mycobacterium paratuberculosis) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium avium complex (MAC) Mycobacterium avium Mycobacterium paratuberculosis Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) (Mycobacterium paratuberculosis) |
| Enzyme Sequence | MVNIVAVRRHGVHVRVIHVPPVQPQPILAPLTPAAIFLVLTVDDGGEATVHEALQDISGLVRAIGFREPQKRLSAIASIGSDVWDRLFSGPRPAELHRFVELHGPRHTAPATPGDLLFHIRAESLDVCFELADRILKSMAGAVTVVDEVHGFRYFDNRDLLGFVDGTENPDGALAVSSTAIGDEDPDFAGSCYVHVQKYLHDMSAWTALSVTEQENVIGRTKLDDIELDDDVKPADAHIALNVITDDDGTELKIVRHNMPFGELGKSEYGTYFIGYSRTPRVTEQMLRNMFLGDPPGNTDRILDFSTAVTGGLFFSPTVDFLDDPPPLPAPGTPAAPPARNGSLSIGSLKGTTR |
| Enzyme Length | 354 |
| Uniprot Accession Number | Q743F4 |
| Absorption | |
| Active Site | ACT_SITE 165; /note=Proton acceptor; /evidence=ECO:0000250|UniProtKB:Q47KB1 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=2 a phenolic donor + H2O2 = 2 a phenolic radical donor + 2 H2O; Xref=Rhea:RHEA:56136, ChEBI:CHEBI:15377, ChEBI:CHEBI:16240, ChEBI:CHEBI:139520, ChEBI:CHEBI:139521; EC=1.11.1.7; Evidence={ECO:0000250|UniProtKB:I6Y4U9}; |
| DNA Binding | |
| EC Number | 1.11.1.7 |
| Enzyme Function | FUNCTION: Cargo protein of a type 1 encapsulin nanocompartment. A heme-dependent peroxidase (By similarity). This cargo-loaded encapsulin nanocompartment is probably involved in protection against oxidative damage (By similarity). {ECO:0000250|UniProtKB:I6WZG6, ECO:0000250|UniProtKB:I6Y4U9}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Metal binding (1); Region (2) |
| Keywords | Cell membrane;Encapsulin nanocompartment;Iron;Membrane;Metal-binding;Oxidoreductase;Peroxidase;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Encapsulin nanocompartment {ECO:0000250|UniProtKB:A0A3T0E4B9, ECO:0000305}. Cell membrane {ECO:0000305|PubMed:25500374}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 38,411 |
| Kinetics | |
| Metal Binding | METAL 238; /note=Iron (heme proximal ligand); /evidence=ECO:0000250|UniProtKB:Q47KB1 |
| Rhea ID | RHEA:56136 |
| Cross Reference Brenda |