| IED ID | IndEnz0018000805 |
| Enzyme Type ID | peroxidase000805 |
| Protein Name |
Peroxygenase 2 AtPXG2 EC 1.11.2.3 Caleosin-2 Embryo-specific protein 2 Putative embryo-specific protein 1 ATS2 |
| Gene Name | PXG2 ATS2 CLO2 At5g55240 MCO15.19 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MTSMERMERDAMETVAPYARVTYHRRVRGDLDDTLPKPYLPRALQAPDMEHPQGTPDHRHNGLSVLQQHVAFFDLDNNGIIYPFETFSGFRLLGFNLLASLILAAGINIALSYATLPGWLPSPFFPIYIHNIHKAKHGSDSKTYDNEGRYTPANLELMFSKYARTIPDKLSLGELWDMTEGNRDAFDFFGWLASKVEWGVLYALASDEEGFLSKEAIRRCFDGSLFEYCAKNYAEIKEYKTYY |
| Enzyme Length | 243 |
| Uniprot Accession Number | Q9FLN9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=RH + ROOH = ROH + ROH.; EC=1.11.2.3; Evidence={ECO:0000269|PubMed:16956885}; |
| DNA Binding | |
| EC Number | 1.11.2.3 |
| Enzyme Function | FUNCTION: Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies. May be involved in the interaction between oil bodies and vacuoles during seed germination and in the oxylipin signaling pathways and plant defense responses. Can catalyze sulfoxidation of thiobenzamide, hydroxylation of aniline and epoxidation of oleic acid. {ECO:0000269|PubMed:15678336}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Domain (1); Initiator methionine (1); Metal binding (5); Modified residue (2); Motif (1) |
| Keywords | Acetylation;Calcium;Disulfide bond;Heme;Iron;Lipid droplet;Metal-binding;Oxidoreductase;Phosphoprotein;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Down-regulated by light and upon germination. Not induced by abscisic acid or osmotic stress. {ECO:0000269|PubMed:11197322, ECO:0000269|PubMed:15678336}. |
| Subcellular Location | SUBCELLULAR LOCATION: Lipid droplet {ECO:0000269|PubMed:21751352}. |
| Modified Residue | MOD_RES 2; /note=N-acetylthreonine; /evidence=ECO:0000255; MOD_RES 224; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:O81270 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12372144; 12805597; 15772289; 16169896; 16504176; 17004082; 17227551; 17420955; 23505340; |
| Motif | MOTIF 117..126; /note=Proline-knot |
| Gene Encoded By | |
| Mass | 27,876 |
| Kinetics | |
| Metal Binding | METAL 69; /note=Iron (heme axial ligand); /evidence=ECO:0000250; METAL 74; /note=Calcium; /evidence=ECO:0000255; METAL 76; /note=Calcium; /evidence=ECO:0000255; METAL 78; /note=Calcium; /evidence=ECO:0000255; METAL 85; /note=Calcium; /evidence=ECO:0000255 |
| Rhea ID | |
| Cross Reference Brenda |