| IED ID | IndEnz0018000821 |
| Enzyme Type ID | peroxidase000821 |
| Protein Name |
Peroxiredoxin PRX1, mitochondrial Prx EC 1.11.1.25 EC 1.11.1.27 1-Cys PRX Glutaredoxin-dependent peroxiredoxin Glutathione-dependent peroxiredoxin Mitochondrial thiol peroxidase mTPx Thioredoxin peroxidase |
| Gene Name | PRX1 YBL064C YBL0503 YBL0524 |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Enzyme Sequence | MFSRICSAQLKRTAWTLPKQAHLQSQTIKTFATAPILCKQFKQSDQPRLRINSDAPNFDADTTVGKINFYDYLGDSWGVLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDVESHEKWIQDIKEIAKVKNVGFPIIGDTFRNVAFLYDMVDAEGFKNINDGSLKTVRSVFVIDPKKKIRLIFTYPSTVGRNTSEVLRVIDALQLTDKEGVVTPINWQPADDVIIPPSVSNDEAKAKFGQFNEIKPYLRFTKSK |
| Enzyme Length | 261 |
| Uniprot Accession Number | P34227 |
| Absorption | |
| Active Site | ACT_SITE 91; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000305|PubMed:10681558 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=a hydroperoxide + 2 glutathione = an alcohol + glutathione disulfide + H2O; Xref=Rhea:RHEA:62632, ChEBI:CHEBI:15377, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297; EC=1.11.1.27; Evidence={ECO:0000269|PubMed:19332553}; CATALYTIC ACTIVITY: Reaction=[glutaredoxin]-dithiol + a hydroperoxide = [glutaredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62624, Rhea:RHEA-COMP:10729, Rhea:RHEA-COMP:10730, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.25; Evidence={ECO:0000269|PubMed:20059400}; |
| DNA Binding | |
| EC Number | 1.11.1.25; 1.11.1.27 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Involved in mitochondrial protection of cadmium-induced oxidative stress. {ECO:0000269|PubMed:10821871, ECO:0000269|PubMed:19332553, ECO:0000269|PubMed:20059400}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7.0 (PubMed:10821871). Optimum pH is 8.5 (using glutaredoxin as electron donor) (PubMed:20059400). {ECO:0000269|PubMed:10821871, ECO:0000269|PubMed:20059400}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Beta strand (9); Chain (1); Disulfide bond (1); Domain (1); Helix (7); Modified residue (1); Mutagenesis (2); Transit peptide (1); Turn (2) |
| Keywords | 3D-structure;Antioxidant;Disulfide bond;Mitochondrion;Oxidoreductase;Peroxidase;Phosphoprotein;Redox-active center;Reference proteome;Transit peptide |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000269|PubMed:10821871, ECO:0000269|PubMed:14576278}. |
| Modified Residue | MOD_RES 53; /note=Phosphoserine; /evidence=ECO:0007744|PubMed:17761666 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 5YKJ; 5YKW; |
| Mapped Pubmed ID | 11018134; 11169096; 11213484; 11805826; 11805837; 11827753; 15051715; 15598536; 16245326; 16328372; 16429126; 16507144; 17360337; 18021067; 18084888; 18084898; 18985429; 19424433; 19536198; 19538506; 19543365; 19841731; 19930686; 20489023; 20547232; 20707985; 20726779; 20934449; 20955007; 21385868; 21779004; 22094416; 22311637; 22770501; 22842922; 22970195; 23396059; 23409974; 25173844; 26024642; 26159064; 26261310; 26813659; 27693354; 28821623; 31389622; 32805320; |
| Motif | |
| Gene Encoded By | |
| Mass | 29,496 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=6.2 uM for H(2)O(2) {ECO:0000269|PubMed:10821871}; KM=10.9 uM for tert-butyl hydroperoxide {ECO:0000269|PubMed:10821871}; KM=8.1 uM for TRX3 {ECO:0000269|PubMed:10821871}; Vmax=8.5 umol/min/mg enzyme for H(2)O(2) {ECO:0000269|PubMed:10821871}; Vmax=7.4 umol/min/mg enzyme for tert-butyl hydroperoxide {ECO:0000269|PubMed:10821871}; Vmax=9.5 umol/min/mg enzyme for TRX3 {ECO:0000269|PubMed:10821871}; |
| Metal Binding | |
| Rhea ID | RHEA:62632; RHEA:62624 |
| Cross Reference Brenda | 1.11.1.25; |