| IED ID | IndEnz0018000822 |
| Enzyme Type ID | peroxidase000822 |
| Protein Name |
Peroxiredoxin-2F, mitochondrial EC 1.11.1.25 Glutaredoxin-dependent peroxiredoxin Peroxiredoxin IIF Thioredoxin peroxidase 2F |
| Gene Name | PRXIIF Os01g0266600 LOC_Os01g16152 P0011D01.6 P0499C11.34 |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice) |
| Enzyme Sequence | MASALLRKATVGGSAAAAAARWASRGLASVGSGSDIVSAAPGVSLQKARSWDEGVATNFSTTPLKDIFHGKKVVIFGLPGAYTGVCSQAHVPSYKNNIDKLKAKGVDSVICVSVNDPYALNGWAEKLQAKDAIEFYGDFDGSFHKSLDLEVDLSAALLGRRSHRWSAFVDDGKIKAFNVEVAPSDFKVSGAEVILDQI |
| Enzyme Length | 198 |
| Uniprot Accession Number | Q9SDD6 |
| Absorption | |
| Active Site | ACT_SITE 86; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:A9PCL4 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[glutaredoxin]-dithiol + a hydroperoxide = [glutaredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62624, Rhea:RHEA-COMP:10729, Rhea:RHEA-COMP:10730, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.25; Evidence={ECO:0000250|UniProtKB:Q9M7T0}; |
| DNA Binding | |
| EC Number | 1.11.1.25 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. Reduces preferentially hydrogen peroxide rather than alkyl peroxides. May be involved in mitochondrial redox homeostasis. {ECO:0000250|UniProtKB:Q9M7T0}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Transit peptide (1) |
| Keywords | Antioxidant;Mitochondrion;Oxidoreductase;Peroxidase;Redox-active center;Reference proteome;Transit peptide |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion matrix {ECO:0000250|UniProtKB:Q9M7T0}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 20,874 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62624 |
| Cross Reference Brenda |