| IED ID | IndEnz0018000857 |
| Enzyme Type ID | peroxidase000857 |
| Protein Name |
Peroxiredoxin 1 EC 1.11.1.24 Cytosolic thioredoxin peroxidase DPx-4783 DmTPx-1 Thioredoxin peroxidase Thioredoxin-dependent peroxiredoxin 1 |
| Gene Name | Jafrac1 TPX-1 CG1633 |
| Organism | Drosophila melanogaster (Fruit fly) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Ephydroidea Drosophilidae (pomace flies) Drosophilinae Drosophilini Drosophila (fruit flies) Sophophora melanogaster group melanogaster subgroup Drosophila melanogaster (Fruit fly) |
| Enzyme Sequence | MPQLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFETTS |
| Enzyme Length | 194 |
| Uniprot Accession Number | Q9V3P0 |
| Absorption | |
| Active Site | ACT_SITE 47; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:Q06830 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000269|PubMed:11677042}; |
| DNA Binding | |
| EC Number | 1.11.1.24 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2) (By similarity). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity). {ECO:0000250|UniProtKB:P0CB50, ECO:0000250|UniProtKB:Q06830}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (2); Domain (1); Modified residue (2) |
| Keywords | Antioxidant;Cytoplasm;Disulfide bond;Oxidoreductase;Peroxidase;Phosphoprotein;Redox-active center;Reference proteome;Ubl conjugation |
| Interact With | P11956 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:11677042}. |
| Modified Residue | MOD_RES 193; /note=Phosphothreonine; /evidence=ECO:0000269|PubMed:18327897; MOD_RES 194; /note=Phosphoserine; /evidence=ECO:0000269|PubMed:18327897 |
| Post Translational Modification | PTM: The enzyme can be inactivated by further oxidation of the cysteine sulfenic acid (C(P)-SOH) to sulphinic acid (C(P)-SO2H) instead of its condensation to a disulfide bond. It can be reactivated by forming a transient disulfide bond with sulfiredoxin SRXN1, which reduces the cysteine sulfinic acid in an ATP- and Mg-dependent manner. {ECO:0000250|UniProtKB:Q06830}.; PTM: Conjugated to URM1, a ubiquitin-like protein. {ECO:0000269|PubMed:28953965}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12556226; 12586708; 12626737; 12727233; 12865422; 14605208; 14657024; 14680800; 14707262; 15094375; 15183715; 15458575; 15621536; 16200348; 16540402; 17101240; 17151602; 17728343; 17907271; 17956857; 18067683; 18433294; 19196346; 19343719; 19543366; 19720829; 19917591; 20015541; 20122915; 20609461; 20818332; 20976250; 21037198; 21111799; 21295275; 21316590; 21338340; 21447707; 21822800; 21890737; 22100409; 22227521; 22450469; 22622569; 23071443; 23416132; 23442797; 23628323; 24070373; 25166757; 25226030; 25242144; 25294943; 25347746; 25474322; 25628309; 25761110; 25776889; 25806047; 25994086; 26117601; 26162375; 26526100; 26637434; 26726767; 26801178; 26865094; 26870755; 27582081; 27956707; 28069988; 28445691; 28634323; 28742844; 29580920; 29670218; 30263675; 30378026; 30818813; 31101394; 31629169; 31722958; 31777173; 31794428; 31799578; 32544407; 32598400; 32773682; 32873627; 32984330; 33289389; 33466414; 33909998; 33920774; 34348164; 34713801; |
| Motif | |
| Gene Encoded By | |
| Mass | 21,738 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62620 |
| Cross Reference Brenda |