| IED ID | IndEnz0018000869 |
| Enzyme Type ID | peroxidase000869 |
| Protein Name |
Peroxiredoxin-2C EC 1.11.1.25 Glutaredoxin-dependent peroxiredoxin Peroxiredoxin IIC Peroxiredoxin TPx2 Thioredoxin peroxidase 2C Thioredoxin-dependent peroxidase 2 |
| Gene Name | PRXIIC TPX2 At1g65970 F12P19.13 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MAPITVGDVVPDGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFIGKAEELKSKGIDEIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDKGLGIRSRRFALLLDNLKVTVANVESGGEFTVSSAEDILKAL |
| Enzyme Length | 162 |
| Uniprot Accession Number | Q9SRZ4 |
| Absorption | |
| Active Site | ACT_SITE 51; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:A9PCL4 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[glutaredoxin]-dithiol + a hydroperoxide = [glutaredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62624, Rhea:RHEA-COMP:10729, Rhea:RHEA-COMP:10730, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.25; Evidence={ECO:0000269|Ref.7}; |
| DNA Binding | |
| EC Number | 1.11.1.25 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. {ECO:0000305|PubMed:15890615}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1) |
| Keywords | Antioxidant;Cytoplasm;Oxidoreductase;Peroxidase;Redox-active center;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Highly induced by salt or oxidative stresses. {ECO:0000269|PubMed:12529539, ECO:0000269|Ref.7}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11997378; 12509532; 14595688; 15032878; 15144374; 15181204; 15632145; 15772289; 16125897; 16299171; 16463051; 16514558; 16606633; 16915352; 17828791; 18307990; 18493039; 18650403; 18820081; 20532806; 25822199; 28627464; 31076517; 31097675; |
| Motif | |
| Gene Encoded By | |
| Mass | 17,414 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: Vmax=8.9 nmol/min/mg enzyme for H(2)O(2) {ECO:0000269|Ref.7}; |
| Metal Binding | |
| Rhea ID | RHEA:62624 |
| Cross Reference Brenda |