Detail Information for IndEnz0018000873
IED ID IndEnz0018000873
Enzyme Type ID peroxidase000873
Protein Name Transcription factor MYB4
Myb-related protein 4
OsMyb4
Transcription factor RLTR1
Gene Name MYB4 LTR1 Os04g0517100 LOC_Os04g43680 OsJ_15470 OSJNBa0073E02.6
Organism Oryza sativa subsp. japonica (Rice)
Taxonomic Lineage cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice)
Enzyme Sequence MGRAPCCEKMGLKKGPWTPEEDKVLVAHIQRHGHGNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEDTIIHLHELLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLDAPAQGGHVAASGGKKHKKPKSAKKPAAAAAAPPASPERSASSSVTESSMASSVAEEHGNAGISSASASVCAKEESSFTSASEEFQIDDSFWSETLSMPLDGYDVSMEPGDAFVAPPSADDMDYWLGVFMESGEAQDLPQI
Enzyme Length 257
Uniprot Accession Number Q7XBH4
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding DNA_BIND 37..61; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00625; DNA_BIND 89..112; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00625
EC Number
Enzyme Function FUNCTION: Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Compositional bias (1); DNA binding (2); Domain (2); Frameshift (1); Region (1); Sequence conflict (2)
Keywords DNA-binding;Nucleus;Reference proteome;Repeat;Stress response;Transcription;Transcription regulation
Interact With
Induction INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}.
Subcellular Location SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00625}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 27,914
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda