| IED ID | IndEnz0018000879 |
| Enzyme Type ID | peroxidase000879 |
| Protein Name |
Bone marrow proteoglycan BMPG Proteoglycan 2 Cleaved into: Eosinophil granule major basic protein EMBP MBP Pregnancy-associated major basic protein |
| Gene Name | PRG2 MBP |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY |
| Enzyme Length | 222 |
| Uniprot Accession Number | P13727 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA. {ECO:0000269|PubMed:10913121}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Beta strand (9); Chain (2); Compositional bias (1); Disulfide bond (4); Domain (1); Glycosylation (6); Helix (2); Natural variant (2); Propeptide (1); Region (1); Sequence conflict (3); Signal peptide (1); Turn (1) |
| Keywords | 3D-structure;Alternative splicing;Antibiotic;Antimicrobial;Cytoplasmic vesicle;Direct protein sequencing;Disulfide bond;Glycoprotein;Heparin-binding;Immunity;Lectin;Nitration;Proteoglycan;Reference proteome;Secreted;Signal |
| Interact With | Q13219 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: [Bone marrow proteoglycan]: Secreted. Note=The proform is secreted.; SUBCELLULAR LOCATION: [Eosinophil granule major basic protein]: Cytoplasmic vesicle, secretory vesicle. Note=The proform is secreted. The mature protein is found in the matrix of the eosinophil's large specific granule (crystalloid core). |
| Modified Residue | |
| Post Translational Modification | PTM: Nitrated. {ECO:0000269|PubMed:18694936}. |
| Signal Peptide | SIGNAL 1..16; /evidence="ECO:0000269|PubMed:7539791, ECO:0000269|PubMed:7685339, ECO:0000269|PubMed:8507662" |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 1H8U; 2BRS; 4QXX; |
| Mapped Pubmed ID | 12202480; 12370176; 12534990; 14500673; 14988014; 15647258; 16169070; 16245931; 16940047; 17082653; 17223728; 18476621; 18720885; 18852884; 19014520; 19039208; 19398958; 19626619; 20237496; 20849415; 20977431; 23033876; 23650620; 24112102; 24814827; 25266917; 25728769; 29936783; 319906; 33689807; 33982062; |
| Motif | |
| Gene Encoded By | |
| Mass | 25,206 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |