| IED ID | IndEnz0018000880 |
| Enzyme Type ID | peroxidase000880 |
| Protein Name |
Bone marrow proteoglycan BMPG Proteoglycan 2 Cleaved into: Eosinophil granule major basic protein EMBP MBP |
| Gene Name | Prg2 Mbp-1 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MKFPLLLALLVGGASALHLSSETSDSKSPLMDENLPRDAEISGPEGEECPPGEELMPLEGEKEEGSGSEGVPGDEGAVSGQDVTDVDLQCPKEEDTTSLMGDSGCKTCRYLLVRRAECFDKAQSVCRRCYRGTLASIHSFSVNFGIQSAVRGINQGQVWIGGRIKGWGRCKRFRWVDGSSWNFAYWAAGQPCPGGGRCVTLCTQGGHWRLSHCVKRRPFICSY |
| Enzyme Length | 223 |
| Uniprot Accession Number | Q61878 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Cytotoxin and helminthotoxin. MBP also induces non-cytolytic histamine release from basophils. It is involved in antiparasitic defense mechanisms and immune hypersensitivity reactions (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Compositional bias (1); Disulfide bond (2); Domain (1); Propeptide (1); Region (1); Signal peptide (1) |
| Keywords | Antibiotic;Antimicrobial;Direct protein sequencing;Disulfide bond;Immunity;Lectin;Nitration;Reference proteome;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasmic granule {ECO:0000250}. Note=Matrix of eosinophil's large specific granule (crystalloid core). {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | PTM: Nitrated. {ECO:0000269|PubMed:18694936}. |
| Signal Peptide | SIGNAL 1..16; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10770291; 11067904; 11170744; 11217851; 12466851; 15100311; 16141072; 16227527; 16299347; 16537572; 16926417; 18430716; 21267068; 21482685; 22131328; 23736699; 24194600; 24626328; 26147683; 26743624; 27480124; 27641493; 28071719; 28515227; 31481482; 31722215; 34616019; 9107694; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,255 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |