| IED ID | IndEnz0018000914 |
| Enzyme Type ID | peroxidase000914 |
| Protein Name |
2-Cys peroxiredoxin BAS1-like, chloroplastic 2-Cys Prx B 2-Cys peroxiredoxin B EC 1.11.1.24 Thiol-specific antioxidant protein B Thioredoxin-dependent peroxiredoxin BAS1-like |
| Gene Name | At5g06290 MHF15.19 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MSMASIASSSSTTLLSSSRVLLPSKSSLLSPTVSFPRIIPSSSASSSSLCSGFSSLGSLTTNRSASRRNFAVKAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI |
| Enzyme Length | 273 |
| Uniprot Accession Number | Q9C5R8 |
| Absorption | |
| Active Site | ACT_SITE 126; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:Q06830 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000250|UniProtKB:Q96291}; |
| DNA Binding | |
| EC Number | 1.11.1.24 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf. {ECO:0000250|UniProtKB:Q96291}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (2); Domain (1); Erroneous initiation (2); Sequence conflict (1); Transit peptide (1) |
| Keywords | Antioxidant;Chloroplast;Disulfide bond;Oxidoreductase;Peroxidase;Plastid;Redox-active center;Reference proteome;Transit peptide |
| Interact With | |
| Induction | INDUCTION: Down-regulated by ascorbate. {ECO:0000269|PubMed:12529539}. |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast {ECO:0000250|UniProtKB:Q96291}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11997378; 12777046; 12885779; 12913160; 14576160; 15028209; 15032878; 15276439; 15632145; 15990873; 16207701; 16606633; 16830180; 16891402; 16915352; 16923014; 17028151; 17054949; 17163439; 17217469; 17828791; 18431481; 18493039; 18538804; 18553980; 18625226; 18633119; 18650403; 18672041; 19835620; 20584316; 20616155; 21798944; 25448674; 25667319; 26138759; 27014325; 27247031; 27717466; 28627464; 28644561; 29128357; 30076598; 30104347; 32564178; |
| Motif | |
| Gene Encoded By | |
| Mass | 29,780 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62620 |
| Cross Reference Brenda |