Detail Information for IndEnz0018000936
IED ID IndEnz0018000936
Enzyme Type ID peroxidase000936
Protein Name Coproheme decarboxylase
EC 1.3.98.5
Coproheme III oxidative decarboxylase
Fe-coproporphyrin III oxidase/dehydrogenase
Hydrogen peroxide-dependent heme synthase
Gene Name chdC hemQ SAOUHSC_00573
Organism Staphylococcus aureus (strain NCTC 8325 / PS 47)
Taxonomic Lineage cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain NCTC 8325 / PS 47)
Enzyme Sequence MSQAAETLDGWYSLHLFYAVDWASLRIVPKDERDALVTEFQSFLENTATVRSSKSGDQAIYNITGQKADLLLWFLRPEMKSLNHIENEFNKLRIADFLIPTYSYVSVIELSNYLAGKSDEDPYENPHIKARLYPELPHSDYICFYPMNKRRNETYNWYMLTMEERQKLMYDHGMIGRKYAGKIKQFITGSVGFDDFEWGVTLFSDDVLQFKKIVYEMRFDETTARYGEFGSFFVGHIINTNEFDQFFAIS
Enzyme Length 250
Uniprot Accession Number Q2G0J1
Absorption
Active Site ACT_SITE 145; /evidence=ECO:0000255|HAMAP-Rule:MF_01442
Activity Regulation
Binding Site BINDING 131; /note=Fe-coproporphyrin III; /evidence=ECO:0000255|HAMAP-Rule:MF_01442; BINDING 185; /note=Fe-coproporphyrin III; /evidence=ECO:0000255|HAMAP-Rule:MF_01442
Calcium Binding
catalytic Activity CATALYTIC ACTIVITY: Reaction=Fe-coproporphyrin III + 2 H(+) + 2 H2O2 = 2 CO2 + 4 H2O + heme b; Xref=Rhea:RHEA:56516, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:16240, ChEBI:CHEBI:16526, ChEBI:CHEBI:60344, ChEBI:CHEBI:68438; EC=1.3.98.5; Evidence={ECO:0000255|HAMAP-Rule:MF_01442, ECO:0000269|PubMed:25908396};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:56517; Evidence={ECO:0000255|HAMAP-Rule:MF_01442, ECO:0000269|PubMed:25908396}; CATALYTIC ACTIVITY: Reaction=Fe-coproporphyrin III + H(+) + H2O2 = CO2 + 2 H2O + harderoheme III; Xref=Rhea:RHEA:57940, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:16240, ChEBI:CHEBI:16526, ChEBI:CHEBI:68438, ChEBI:CHEBI:142463; Evidence={ECO:0000255|HAMAP-Rule:MF_01442};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:57941; Evidence={ECO:0000255|HAMAP-Rule:MF_01442, ECO:0000269|PubMed:25908396}; CATALYTIC ACTIVITY: Reaction=H(+) + H2O2 + harderoheme III = CO2 + 2 H2O + heme b; Xref=Rhea:RHEA:57944, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:16240, ChEBI:CHEBI:16526, ChEBI:CHEBI:60344, ChEBI:CHEBI:142463; Evidence={ECO:0000255|HAMAP-Rule:MF_01442};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:57945; Evidence={ECO:0000255|HAMAP-Rule:MF_01442, ECO:0000269|PubMed:25908396};
DNA Binding
EC Number 1.3.98.5
Enzyme Function FUNCTION: Involved in coproporphyrin-dependent heme b biosynthesis (PubMed:25908396). Catalyzes the decarboxylation of Fe-coproporphyrin III (coproheme) to heme b (protoheme IX), the last step of the pathway (By similarity). The reaction occurs in a stepwise manner with a three-propionate harderoheme intermediate (By similarity). Can stimulate the generation of protoporphyrin IX, but not coproporphyrin III, by HemY (PubMed:27597779). {ECO:0000255|HAMAP-Rule:MF_01442, ECO:0000269|PubMed:25908396, ECO:0000269|PubMed:27597779}.
Temperature Dependency
PH Dependency
Pathway PATHWAY: Porphyrin-containing compound metabolism; protoheme biosynthesis. {ECO:0000255|HAMAP-Rule:MF_01442, ECO:0000305|PubMed:25908396}.
nucleotide Binding
Features Active site (1); Binding site (2); Chain (1); Metal binding (1); Region (1)
Keywords Heme;Heme biosynthesis;Iron;Metal-binding;Oxidoreductase;Reference proteome
Interact With
Induction
Subcellular Location
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 29,390
Kinetics
Metal Binding METAL 172; /note=Iron (Fe-coproporphyrin III axial ligand); /evidence=ECO:0000255|HAMAP-Rule:MF_01442
Rhea ID RHEA:56516; RHEA:56517; RHEA:57940; RHEA:57941; RHEA:57944; RHEA:57945
Cross Reference Brenda