| IED ID | IndEnz0018001009 |
| Enzyme Type ID | peroxidase001009 |
| Protein Name |
2-Cys peroxiredoxin BAS1, chloroplastic EC 1.11.1.24 Thiol-specific antioxidant protein Thioredoxin-dependent peroxiredoxin BAS1 |
| Gene Name | BAS1 Os02g0537700 LOC_Os02g33450 OsJ_07037 OSJNBa0014M17.2 P0508B05.23 |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice) |
| Enzyme Sequence | MAACCSSLATAVSSSSAKPLAGIPPAAPHSLSLPRAPAARPLRLSASSSRSARASSFVARAGGVDDAPLVGNKAPDFDAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYDEFEKLNTEILGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQYVQDNPDEVCPAGWKPGDKSMKPDPKGSKEYFAAI |
| Enzyme Length | 261 |
| Uniprot Accession Number | Q6ER94 |
| Absorption | |
| Active Site | ACT_SITE 114; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:Q06830 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000250|UniProtKB:Q96291}; |
| DNA Binding | |
| EC Number | 1.11.1.24 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides (PubMed:16891402, PubMed:19345687). May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf (By similarity). {ECO:0000250|UniProtKB:Q96291, ECO:0000269|PubMed:16891402, ECO:0000269|PubMed:19345687}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (2); Domain (1); Mutagenesis (1); Transit peptide (1) |
| Keywords | Antioxidant;Chloroplast;Direct protein sequencing;Disulfide bond;Hydrogen peroxide;Oxidoreductase;Peroxidase;Plastid;Redox-active center;Reference proteome;Transit peptide |
| Interact With | Q70G58 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast {ECO:0000250|UniProtKB:Q96291}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 17185738; 19357089; 20435900; 21418356; 21718517; 25448674; 25885817; 26125917; 26400311; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,097 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62620 |
| Cross Reference Brenda |