| IED ID | IndEnz0018001027 |
| Enzyme Type ID | peroxidase001027 |
| Protein Name |
Glutathione S-transferase F9 AtGSTF9 EC 2.5.1.18 AtGSTF7 GST class-phi member 9 |
| Gene Name | GSTF9 GLUTTR GSTF7 Phi9 At2g30860 F7F1.7 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MVLKVYGPHFASPKRALVTLIEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFESRAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMFASVMGFPSDEKLIKESEEKLAGVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPIGKAYMIKDRKHVSAWWDDISSRPAWKETVAKYSFPA |
| Enzyme Length | 215 |
| Uniprot Accession Number | O80852 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Redox-regulated enzyme; in oxidative stress conditions methionine oxidation ensure a thermodynamic and structural compensatory mechanism to guarantee H(2)O(2) peroxidase activity despite transferase activity inhibition. {ECO:0000269|PubMed:29732642}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=glutathione + RX = a halide anion + an S-substituted glutathione + H(+); Xref=Rhea:RHEA:16437, ChEBI:CHEBI:15378, ChEBI:CHEBI:16042, ChEBI:CHEBI:17792, ChEBI:CHEBI:57925, ChEBI:CHEBI:90779; EC=2.5.1.18; Evidence={ECO:0000269|PubMed:12090627, ECO:0000269|PubMed:16538523}; |
| DNA Binding | |
| EC Number | 2.5.1.18 |
| Enzyme Function | FUNCTION: In vitro, possesses glutathione S-transferase activity toward 1-chloro-2,4-dinitrobenzene (CDNB) and benzyl isothiocyanate (BITC), and glutathione peroxidase activity toward cumene hydroperoxide and linoleic acid-13-hydroperoxide. May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides. {ECO:0000269|PubMed:12090627, ECO:0000269|PubMed:16538523}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Beta strand (6); Chain (1); Domain (2); Frameshift (1); Helix (13); Modified residue (5); Region (4); Sequence conflict (2); Turn (3) |
| Keywords | 3D-structure;Alternative splicing;Cytoplasm;Detoxification;Oxidation;Oxidoreductase;Peroxidase;Phosphoprotein;Reference proteome;Stress response;Transferase |
| Interact With | |
| Induction | INDUCTION: By zinc in roots and benoxacor. {ECO:0000269|PubMed:16538523, ECO:0000269|PubMed:19880396}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000305}. |
| Modified Residue | MOD_RES 12; /note=Phosphoserine; /evidence=ECO:0007744|PubMed:19376835; MOD_RES 35; /note=Methionine sulfoxide; /evidence=ECO:0000269|PubMed:29732642; MOD_RES 118; /note=Methionine sulfoxide; /evidence=ECO:0000269|PubMed:29732642; MOD_RES 123; /note=Methionine sulfoxide; /evidence=ECO:0000269|PubMed:29732642; MOD_RES 184; /note=Methionine sulfoxide; /evidence=ECO:0000269|PubMed:29732642 |
| Post Translational Modification | PTM: Oxidated at Met-35, Met-118, Met-123 and Met-184 in oxidative stress conditions (e.g. hydrogen peroxide H(2)O(2)). {ECO:0000269|PubMed:29732642}. |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 6EZY; 6F01; 6F05; |
| Mapped Pubmed ID | 10785664; 11826309; 14535880; 15159623; 15539469; 15971193; 16526091; 16648217; 17028151; 17644812; 18431481; 18485061; 18538804; 18633119; 19067976; 19174456; 20005002; 20018591; 20377703; 20405473; 20442276; 23281391; 23289948; 23661340; 26616373; 28627464; 29165718; 31870857; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,146 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=71 uM for glutathione (in oxidative conditions) {ECO:0000269|PubMed:29732642}; KM=131 uM for glutathione (in reductive conditions) {ECO:0000269|PubMed:29732642}; KM=1.8 mM for 1-chloro-2,4-dinitrobenzene (in oxidative conditions) {ECO:0000269|PubMed:29732642}; KM=1.3 mM for 1-chloro-2,4-dinitrobenzene (in reductive conditions) {ECO:0000269|PubMed:29732642}; Note=kcat is 0.5 sec(-1) with glutathione as substrate (in oxidative conditions) (PubMed:29732642). kcat is 0.85 sec(-1) with glutathione as substrate (in reductive conditions) (PubMed:29732642). kcat is 0.72 sec(-1) with 1-chloro-2,4-dinitrobenzene as substrate (in oxidative conditions) (PubMed:29732642). kcat is 0.98 sec(-1) with 1-chloro-2,4-dinitrobenzene as substrate (in reductive conditions) (PubMed:29732642). {ECO:0000269|PubMed:29732642}; |
| Metal Binding | |
| Rhea ID | RHEA:16437 |
| Cross Reference Brenda |